Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2696157..2696414 | Replicon | chromosome |
| Accession | NZ_CP026805 | ||
| Organism | Shigella dysenteriae strain 2017C-4522 | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | Q31V67 |
| Locus tag | C1P73_RS14520 | Protein ID | WP_001135724.1 |
| Coordinates | 2696262..2696414 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 2696157..2696211 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P73_RS14490 | 2691667..2691897 | - | 231 | Protein_2806 | IS4 family transposase | - |
| C1P73_RS14495 | 2691901..2692110 | - | 210 | Protein_2807 | IS66 family insertion sequence element accessory protein TnpB | - |
| C1P73_RS14500 | 2692107..2692463 | - | 357 | WP_000239757.1 | transposase | - |
| C1P73_RS14505 | 2692614..2693756 | + | 1143 | Protein_2809 | IS4-like element IS4 family transposase | - |
| - | 2696157..2696211 | - | 55 | - | - | Antitoxin |
| C1P73_RS14520 | 2696262..2696414 | + | 153 | WP_001135724.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| C1P73_RS25610 | 2696403..2696462 | - | 60 | WP_212732943.1 | hypothetical protein | - |
| C1P73_RS14525 | 2696593..2696805 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| C1P73_RS14530 | 2697086..2697376 | - | 291 | WP_005045913.1 | HTH-type transcriptional regulator | - |
| C1P73_RS14540 | 2698585..2699295 | + | 711 | WP_004987320.1 | DUF3053 domain-containing protein | - |
| C1P73_RS14545 | 2699345..2700319 | - | 975 | WP_000805034.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| C1P73_RS14550 | 2700423..2701010 | - | 588 | WP_000747616.1 | OmpA family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 2692107..2698008 | 5901 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5868.09 Da Isoelectric Point: 7.7173
>T96094 WP_001135724.1 NZ_CP026805:2696262-2696414 [Shigella dysenteriae]
MPQKYGLLSLIVICFTLLFFTWMVRDSLCELHIKQGRYELAAFLACNLKE
MPQKYGLLSLIVICFTLLFFTWMVRDSLCELHIKQGRYELAAFLACNLKE
Download Length: 153 bp
>T96094 NZ_CP026805:2696262-2696414 [Shigella dysenteriae]
ATGCCGCAAAAATACGGATTACTTTCATTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGGTAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGCGTTATGAGCTGGCGGCATTTTTAGCCTGCAATTTAAAAGAGTAA
ATGCCGCAAAAATACGGATTACTTTCATTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGGTAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGCGTTATGAGCTGGCGGCATTTTTAGCCTGCAATTTAAAAGAGTAA
Antitoxin
Download Length: 55 bp
>AT96094 NZ_CP026805:c2696211-2696157 [Shigella dysenteriae]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|