Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1016719..1016944 | Replicon | chromosome |
| Accession | NZ_CP026805 | ||
| Organism | Shigella dysenteriae strain 2017C-4522 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | C1P73_RS05795 | Protein ID | WP_000813254.1 |
| Coordinates | 1016719..1016874 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1016886..1016944 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P73_RS05755 | 1011867..1013135 | - | 1269 | Protein_1121 | prophage tail fiber N-terminal domain-containing protein | - |
| C1P73_RS05760 | 1013159..1013704 | - | 546 | WP_000902849.1 | tail fiber assembly protein | - |
| C1P73_RS25430 | 1013707..1013775 | - | 69 | Protein_1123 | phage tail protein | - |
| C1P73_RS05765 | 1013831..1014528 | + | 698 | WP_134795416.1 | IS1-like element IS1SD family transposase | - |
| C1P73_RS05770 | 1014544..1015472 | + | 929 | Protein_1125 | IS3-like element IS600 family transposase | - |
| C1P73_RS05780 | 1015522..1016271 | - | 750 | Protein_1126 | hypothetical protein | - |
| C1P73_RS05785 | 1016273..1016551 | - | 279 | WP_000929754.1 | hypothetical protein | - |
| C1P73_RS05795 | 1016719..1016874 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 1016886..1016944 | + | 59 | - | - | Antitoxin |
| C1P73_RS05810 | 1017525..1017941 | - | 417 | WP_005069274.1 | hypothetical protein | - |
| C1P73_RS05815 | 1018053..1018274 | + | 222 | WP_134796774.1 | transposase | - |
| C1P73_RS05820 | 1018271..1018432 | + | 162 | WP_000171090.1 | hypothetical protein | - |
| C1P73_RS05825 | 1018429..1018776 | + | 348 | WP_000612610.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| C1P73_RS05830 | 1018825..1020363 | + | 1539 | WP_000099181.1 | IS66-like element ISEc22 family transposase | - |
| C1P73_RS05835 | 1020413..1020868 | - | 456 | WP_000335375.1 | ead/Ea22-like family protein | - |
| C1P73_RS05840 | 1020855..1021160 | - | 306 | WP_001266147.1 | DUF4406 domain-containing protein | - |
| C1P73_RS05845 | 1021157..1021579 | - | 423 | WP_001151146.1 | DUF977 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ipaH9.8 | 982432..1070349 | 87917 | |
| - | inside | IScluster/Tn | - | ipaH9.8 | 1001122..1025402 | 24280 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T96087 WP_000813254.1 NZ_CP026805:c1016874-1016719 [Shigella dysenteriae]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T96087 NZ_CP026805:c1016874-1016719 [Shigella dysenteriae]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT96087 NZ_CP026805:1016886-1016944 [Shigella dysenteriae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|