Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 307525..307750 | Replicon | chromosome |
| Accession | NZ_CP026805 | ||
| Organism | Shigella dysenteriae strain 2017C-4522 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | C1P73_RS01765 | Protein ID | WP_000813254.1 |
| Coordinates | 307595..307750 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 307525..307583 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P73_RS01710 | 302858..303154 | + | 297 | WP_001266130.1 | DUF4406 domain-containing protein | - |
| C1P73_RS01715 | 303151..303612 | + | 462 | WP_001209470.1 | sigma-E factor regulatory protein RseB domain-containing protein | - |
| C1P73_RS01720 | 303590..303946 | + | 357 | WP_000403782.1 | hypothetical protein | - |
| C1P73_RS01725 | 304042..304224 | + | 183 | WP_001224665.1 | hypothetical protein | - |
| C1P73_RS24945 | 304217..304393 | + | 177 | WP_000753053.1 | hypothetical protein | - |
| C1P73_RS01730 | 304390..304749 | + | 360 | WP_001289986.1 | hypothetical protein | - |
| C1P73_RS01735 | 304750..304965 | + | 216 | WP_000510387.1 | hypothetical protein | - |
| C1P73_RS01740 | 304967..305185 | + | 219 | WP_001142588.1 | DUF4014 family protein | - |
| C1P73_RS01745 | 305187..305450 | + | 264 | WP_000224216.1 | hypothetical protein | - |
| C1P73_RS01750 | 305461..305628 | + | 168 | WP_000207997.1 | hypothetical protein | - |
| C1P73_RS01755 | 305827..307055 | + | 1229 | WP_167544911.1 | IS3-like element IS2 family transposase | - |
| C1P73_RS01760 | 307070..307303 | + | 234 | WP_000350274.1 | hypothetical protein | - |
| - | 307525..307583 | - | 59 | - | - | Antitoxin |
| C1P73_RS01765 | 307595..307750 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| C1P73_RS01770 | 307967..308218 | + | 252 | WP_000980988.1 | protein Rem | - |
| C1P73_RS01775 | 308285..308563 | + | 279 | WP_032335658.1 | hypothetical protein | - |
| C1P73_RS01780 | 308565..309611 | + | 1047 | WP_001265091.1 | DUF968 domain-containing protein | - |
| C1P73_RS01785 | 309624..309998 | + | 375 | WP_073817556.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C1P73_RS01790 | 309995..310816 | + | 822 | WP_000762933.1 | antitermination protein | - |
| C1P73_RS01795 | 311043..311283 | + | 241 | Protein_346 | hypothetical protein | - |
| C1P73_RS01800 | 311391..312449 | + | 1059 | WP_000935541.1 | site-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 291670..346272 | 54602 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T96077 WP_000813254.1 NZ_CP026805:307595-307750 [Shigella dysenteriae]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T96077 NZ_CP026805:307595-307750 [Shigella dysenteriae]
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT96077 NZ_CP026805:c307583-307525 [Shigella dysenteriae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|