Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1618016..1618241 | Replicon | chromosome |
Accession | NZ_CP026799 | ||
Organism | Shigella flexneri strain NCTC 9728 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | C1P82_RS08135 | Protein ID | WP_000813254.1 |
Coordinates | 1618086..1618241 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1618016..1618074 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1P82_RS08095 | 1613831..1614868 | - | 1038 | WP_005105555.1 | tyrosine-type recombinase/integrase | - |
C1P82_RS08100 | 1614868..1615044 | - | 177 | WP_044023995.1 | DUF4224 domain-containing protein | - |
C1P82_RS08105 | 1615077..1615774 | + | 698 | Protein_1551 | IS1 family transposase | - |
C1P82_RS08110 | 1615906..1616220 | - | 315 | WP_001317924.1 | 3'-5' exoribonuclease | - |
C1P82_RS08115 | 1616250..1616947 | - | 698 | Protein_1553 | IS1 family transposase | - |
C1P82_RS08120 | 1617018..1617434 | + | 417 | WP_005069274.1 | hypothetical protein | - |
- | 1618016..1618074 | - | 59 | - | - | Antitoxin |
C1P82_RS08135 | 1618086..1618241 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
C1P82_RS08140 | 1618283..1618468 | - | 186 | WP_001302544.1 | hypothetical protein | - |
C1P82_RS08145 | 1618409..1618687 | + | 279 | WP_011069426.1 | hypothetical protein | - |
C1P82_RS08150 | 1618689..1619747 | + | 1059 | Protein_1558 | DUF968 domain-containing protein | - |
C1P82_RS08155 | 1619748..1620113 | + | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
C1P82_RS08160 | 1620110..1620797 | + | 688 | Protein_1560 | antiterminator | - |
C1P82_RS24100 | 1620827..1620948 | + | 122 | Protein_1561 | antiterminator | - |
C1P82_RS08185 | 1621593..1621808 | + | 216 | WP_000839572.1 | class II holin family protein | - |
C1P82_RS08190 | 1621907..1622581 | + | 675 | WP_134800537.1 | IS66-like element accessory protein TnpA | - |
C1P82_RS08195 | 1622578..1622925 | + | 348 | WP_000631709.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ipaH9.8 | 1607915..1643077 | 35162 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T96018 WP_000813254.1 NZ_CP026799:1618086-1618241 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T96018 NZ_CP026799:1618086-1618241 [Shigella flexneri]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT96018 NZ_CP026799:c1618074-1618016 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|