Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2353908..2354133 | Replicon | chromosome |
| Accession | NZ_CP026795 | ||
| Organism | Shigella boydii strain ATCC BAA-1247 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | C5B80_RS12600 | Protein ID | WP_000813254.1 |
| Coordinates | 2353908..2354063 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2354075..2354133 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C5B80_RS12550 | 2349056..2350212 | + | 1157 | WP_134796775.1 | IS3 family transposase | - |
| C5B80_RS12560 | 2350256..2350555 | - | 300 | Protein_2392 | DUF968 domain-containing protein | - |
| C5B80_RS12565 | 2350595..2352133 | - | 1539 | WP_000099170.1 | IS66-like element ISEc22 family transposase | - |
| C5B80_RS12570 | 2352182..2352529 | - | 348 | WP_000612626.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| C5B80_RS12575 | 2352526..2352906 | - | 381 | WP_001333468.1 | IS66 family insertion sequence hypothetical protein | - |
| C5B80_RS12585 | 2352999..2353460 | - | 462 | Protein_2396 | hypothetical protein | - |
| C5B80_RS12590 | 2353462..2353740 | - | 279 | WP_000929754.1 | hypothetical protein | - |
| C5B80_RS12600 | 2353908..2354063 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2354075..2354133 | + | 59 | - | - | Antitoxin |
| C5B80_RS12615 | 2354715..2355157 | - | 443 | Protein_2399 | hypothetical protein | - |
| C5B80_RS12620 | 2355201..2355581 | + | 381 | WP_001333468.1 | IS66 family insertion sequence hypothetical protein | - |
| C5B80_RS12625 | 2355578..2355925 | + | 348 | WP_000612626.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| C5B80_RS12630 | 2355974..2357512 | + | 1539 | WP_134802545.1 | IS66-like element ISEc22 family transposase | - |
| C5B80_RS12635 | 2357509..2357868 | + | 360 | WP_073692993.1 | 3'-5' exoribonuclease | - |
| C5B80_RS12640 | 2357927..2358130 | + | 204 | WP_000096344.1 | DUF4224 domain-containing protein | - |
| C5B80_RS12645 | 2358130..2358485 | + | 356 | Protein_2405 | integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | rhs/PAAR / ipaH9.8 | 2276162..2372784 | 96622 | |
| - | inside | IScluster/Tn | - | - | 2348231..2359686 | 11455 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T96006 WP_000813254.1 NZ_CP026795:c2354063-2353908 [Shigella boydii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T96006 NZ_CP026795:c2354063-2353908 [Shigella boydii]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT96006 NZ_CP026795:2354075-2354133 [Shigella boydii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|