Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4699560..4699785 | Replicon | chromosome |
Accession | NZ_CP026793 | ||
Organism | Shigella flexneri strain 74-1170 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | C1P81_RS24165 | Protein ID | WP_000813254.1 |
Coordinates | 4699560..4699715 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 4699727..4699785 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1P81_RS24100 | 4694872..4695222 | - | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
C1P81_RS24105 | 4695219..4695893 | - | 675 | WP_004967157.1 | IS66-like element accessory protein TnpA | - |
C1P81_RS24110 | 4695992..4696207 | - | 216 | WP_000839572.1 | class II holin family protein | - |
C1P81_RS24140 | 4697003..4697691 | - | 689 | Protein_4626 | bacteriophage antitermination protein Q | - |
C1P81_RS24145 | 4697688..4698053 | - | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
C1P81_RS24150 | 4698054..4699112 | - | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
C1P81_RS24155 | 4699114..4699392 | - | 279 | WP_011069426.1 | hypothetical protein | - |
C1P81_RS24165 | 4699560..4699715 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 4699727..4699785 | + | 59 | - | - | Antitoxin |
C1P81_RS24180 | 4700367..4700783 | - | 417 | WP_005069274.1 | hypothetical protein | - |
C1P81_RS24185 | 4700810..4700950 | + | 141 | Protein_4632 | DUF4224 domain-containing protein | - |
C1P81_RS24190 | 4700950..4702000 | + | 1051 | Protein_4633 | tyrosine-type recombinase/integrase | - |
C1P81_RS24200 | 4702211..4703008 | + | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
C1P81_RS24210 | 4703346..4704608 | + | 1263 | Protein_4635 | tyrosine-type recombinase/integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ipaH9.8 | 4682160..4732963 | 50803 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T95988 WP_000813254.1 NZ_CP026793:c4699715-4699560 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T95988 NZ_CP026793:c4699715-4699560 [Shigella flexneri]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT95988 NZ_CP026793:4699727-4699785 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|