Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4018567..4018792 | Replicon | chromosome |
Accession | NZ_CP026793 | ||
Organism | Shigella flexneri strain 74-1170 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | C1P81_RS20310 | Protein ID | WP_000813254.1 |
Coordinates | 4018637..4018792 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 4018567..4018625 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1P81_RS26975 | 4014565..4014734 | + | 170 | Protein_3891 | hypothetical protein | - |
C1P81_RS20275 | 4014880..4015626 | + | 747 | WP_000788996.1 | ATP-binding protein | - |
C1P81_RS20280 | 4015641..4016063 | + | 423 | WP_001118168.1 | DUF977 family protein | - |
C1P81_RS20285 | 4016121..4016477 | + | 357 | WP_005048249.1 | hypothetical protein | - |
C1P81_RS20290 | 4016570..4016788 | + | 219 | WP_000256998.1 | DUF4014 family protein | - |
C1P81_RS20295 | 4016790..4017155 | + | 366 | WP_001229298.1 | HNH endonuclease signature motif containing protein | - |
C1P81_RS20300 | 4017152..4017817 | + | 666 | WP_000208062.1 | hypothetical protein | - |
C1P81_RS20305 | 4017817..4018182 | + | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
- | 4018567..4018625 | - | 59 | - | - | Antitoxin |
C1P81_RS20310 | 4018637..4018792 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
C1P81_RS20325 | 4020129..4020728 | + | 600 | WP_000940329.1 | DUF1367 family protein | - |
C1P81_RS20330 | 4020728..4021018 | + | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
C1P81_RS20335 | 4021015..4021569 | + | 555 | WP_000640143.1 | DUF1133 family protein | - |
C1P81_RS20340 | 4021722..4021895 | + | 174 | WP_000504450.1 | hypothetical protein | - |
C1P81_RS20345 | 4021957..4023113 | + | 1157 | WP_094106037.1 | IS3-like element IS600 family transposase | - |
C1P81_RS20350 | 4023184..4023666 | + | 483 | WP_000068107.1 | ORF6N domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | sitABCD | ipaH9.8 | 4010650..4076038 | 65388 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T95977 WP_000813254.1 NZ_CP026793:4018637-4018792 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T95977 NZ_CP026793:4018637-4018792 [Shigella flexneri]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT95977 NZ_CP026793:c4018625-4018567 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|