Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2724921..2725146 | Replicon | chromosome |
| Accession | NZ_CP026792 | ||
| Organism | Shigella flexneri strain 61-4982 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | C1P80_RS14370 | Protein ID | WP_000813254.1 |
| Coordinates | 2724921..2725076 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2725088..2725146 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P80_RS14330 | 2720047..2720553 | - | 507 | WP_045178261.1 | ORF6N domain-containing protein | - |
| C1P80_RS14340 | 2721818..2722003 | - | 186 | WP_005049799.1 | hypothetical protein | - |
| C1P80_RS14345 | 2722144..2722698 | - | 555 | WP_000640143.1 | DUF1133 family protein | - |
| C1P80_RS14350 | 2722695..2722985 | - | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
| C1P80_RS14355 | 2722985..2723584 | - | 600 | WP_000940329.1 | DUF1367 family protein | - |
| C1P80_RS14360 | 2723718..2724415 | + | 698 | Protein_2644 | IS1 family transposase | - |
| C1P80_RS14370 | 2724921..2725076 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2725088..2725146 | + | 59 | - | - | Antitoxin |
| C1P80_RS14375 | 2725531..2725896 | - | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
| C1P80_RS14380 | 2725896..2726561 | - | 666 | WP_000208062.1 | hypothetical protein | - |
| C1P80_RS14385 | 2726558..2726923 | - | 366 | WP_001229298.1 | HNH endonuclease | - |
| C1P80_RS14390 | 2726925..2727143 | - | 219 | WP_000256998.1 | DUF4014 family protein | - |
| C1P80_RS14395 | 2727236..2727592 | - | 357 | WP_005048249.1 | hypothetical protein | - |
| C1P80_RS14400 | 2727650..2728072 | - | 423 | WP_001118167.1 | DUF977 family protein | - |
| C1P80_RS14405 | 2728087..2728833 | - | 747 | WP_000788996.1 | ATP-binding protein | - |
| C1P80_RS24510 | 2729326..2729580 | - | 255 | Protein_2653 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | sitABCD | ipaH9.8 | 2688631..2730732 | 42101 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T95963 WP_000813254.1 NZ_CP026792:c2725076-2724921 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T95963 NZ_CP026792:c2725076-2724921 [Shigella flexneri]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT95963 NZ_CP026792:2725088-2725146 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|