Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2071589..2071814 | Replicon | chromosome |
| Accession | NZ_CP026792 | ||
| Organism | Shigella flexneri strain 61-4982 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | C1P80_RS10720 | Protein ID | WP_000813254.1 |
| Coordinates | 2071659..2071814 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2071589..2071647 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P80_RS10675 | 2066766..2068028 | - | 1263 | Protein_1959 | tyrosine-type recombinase/integrase | - |
| C1P80_RS10685 | 2068366..2069163 | - | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
| C1P80_RS10695 | 2069399..2070424 | - | 1026 | WP_000533619.1 | tyrosine-type recombinase/integrase | - |
| C1P80_RS10700 | 2070424..2070564 | - | 141 | Protein_1962 | DUF4224 domain-containing protein | - |
| C1P80_RS10705 | 2070591..2071007 | + | 417 | WP_005069274.1 | hypothetical protein | - |
| - | 2071589..2071647 | - | 59 | - | - | Antitoxin |
| C1P80_RS10720 | 2071659..2071814 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| C1P80_RS10730 | 2071982..2072260 | + | 279 | WP_011069426.1 | hypothetical protein | - |
| C1P80_RS10735 | 2072262..2073320 | + | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
| C1P80_RS10740 | 2073321..2073686 | + | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C1P80_RS10745 | 2073683..2074366 | + | 684 | WP_005049343.1 | antiterminator | - |
| C1P80_RS10775 | 2075167..2075382 | + | 216 | WP_000839572.1 | class II holin family protein | - |
| C1P80_RS10780 | 2075481..2075672 | + | 192 | Protein_1970 | helix-turn-helix domain-containing protein | - |
| C1P80_RS10785 | 2075684..2076381 | - | 698 | Protein_1971 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ipaH9.8 | 2035850..2093996 | 58146 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T95960 WP_000813254.1 NZ_CP026792:2071659-2071814 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T95960 NZ_CP026792:2071659-2071814 [Shigella flexneri]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT95960 NZ_CP026792:c2071647-2071589 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|