Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 943160..943385 | Replicon | chromosome |
Accession | NZ_CP026788 | ||
Organism | Shigella flexneri 2a strain ATCC 29903 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | C1P79_RS05205 | Protein ID | WP_000813254.1 |
Coordinates | 943160..943315 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 943327..943385 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1P79_RS05165 | 938286..938768 | - | 483 | WP_000068107.1 | ORF6N domain-containing protein | - |
C1P79_RS05175 | 940057..940230 | - | 174 | WP_000504450.1 | hypothetical protein | - |
C1P79_RS05180 | 940383..940937 | - | 555 | WP_000640143.1 | DUF1133 family protein | - |
C1P79_RS05185 | 940934..941224 | - | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
C1P79_RS05190 | 941224..941823 | - | 600 | WP_000940329.1 | DUF1367 family protein | - |
C1P79_RS05195 | 941957..942654 | + | 698 | WP_225620329.1 | IS1 family transposase | - |
C1P79_RS05205 | 943160..943315 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 943327..943385 | + | 59 | - | - | Antitoxin |
C1P79_RS05210 | 943770..944135 | - | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
C1P79_RS05215 | 944135..944800 | - | 666 | WP_000208062.1 | hypothetical protein | - |
C1P79_RS05220 | 944797..945162 | - | 366 | WP_001229298.1 | HNH endonuclease signature motif containing protein | - |
C1P79_RS05225 | 945164..945382 | - | 219 | WP_000256998.1 | DUF4014 family protein | - |
C1P79_RS05230 | 945475..945831 | - | 357 | WP_005048249.1 | hypothetical protein | - |
C1P79_RS05235 | 945889..946311 | - | 423 | WP_001118168.1 | DUF977 family protein | - |
C1P79_RS05240 | 946326..947072 | - | 747 | WP_000788996.1 | ATP-binding protein | - |
C1P79_RS26165 | 947218..947387 | - | 170 | Protein_988 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | sitABCD | ipaH9.8 | 889553..956417 | 66864 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T95942 WP_000813254.1 NZ_CP026788:c943315-943160 [Shigella flexneri 2a]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T95942 NZ_CP026788:c943315-943160 [Shigella flexneri 2a]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT95942 NZ_CP026788:943327-943385 [Shigella flexneri 2a]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|