Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 250777..251002 | Replicon | chromosome |
Accession | NZ_CP026788 | ||
Organism | Shigella flexneri 2a strain ATCC 29903 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | C1P79_RS01295 | Protein ID | WP_000813254.1 |
Coordinates | 250847..251002 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 250777..250835 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1P79_RS01250 | 245954..247216 | - | 1263 | Protein_234 | tyrosine-type recombinase/integrase | - |
C1P79_RS01260 | 247554..248351 | - | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
C1P79_RS01270 | 248562..249612 | - | 1051 | Protein_236 | tyrosine-type recombinase/integrase | - |
C1P79_RS01275 | 249612..249752 | - | 141 | Protein_237 | DUF4224 domain-containing protein | - |
C1P79_RS01280 | 249779..250195 | + | 417 | WP_005069274.1 | hypothetical protein | - |
- | 250777..250835 | - | 59 | - | - | Antitoxin |
C1P79_RS01295 | 250847..251002 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
C1P79_RS01305 | 251170..251448 | + | 279 | WP_011069426.1 | hypothetical protein | - |
C1P79_RS01310 | 251450..252508 | + | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
C1P79_RS01315 | 252509..252874 | + | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
C1P79_RS01320 | 252871..253559 | + | 689 | Protein_243 | bacteriophage antitermination protein Q | - |
C1P79_RS01350 | 254355..254570 | + | 216 | WP_000839572.1 | class II holin family protein | - |
C1P79_RS01355 | 254669..255343 | + | 675 | WP_004967157.1 | IS66-like element accessory protein TnpA | - |
C1P79_RS01360 | 255340..255690 | + | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ipaH9.8 | 206932..282852 | 75920 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T95931 WP_000813254.1 NZ_CP026788:250847-251002 [Shigella flexneri 2a]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T95931 NZ_CP026788:250847-251002 [Shigella flexneri 2a]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT95931 NZ_CP026788:c250835-250777 [Shigella flexneri 2a]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|