Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3213637..3213859 | Replicon | chromosome |
| Accession | NZ_CP026776 | ||
| Organism | Shigella flexneri strain 98-3193 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | C1P84_RS16580 | Protein ID | WP_001295224.1 |
| Coordinates | 3213752..3213859 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3213637..3213703 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P84_RS16560 | 3209078..3209980 | + | 903 | WP_000084666.1 | dipeptide ABC transporter permease DppC | - |
| C1P84_RS16565 | 3209991..3210974 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| C1P84_RS16570 | 3210971..3211975 | + | 1005 | WP_000107041.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| C1P84_RS16575 | 3212005..3213276 | - | 1272 | WP_005052340.1 | aromatic amino acid transport family protein | - |
| - | 3213637..3213703 | - | 67 | - | - | Antitoxin |
| C1P84_RS16580 | 3213752..3213859 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 3214121..3214177 | - | 57 | NuclAT_23 | - | - |
| - | 3214121..3214177 | - | 57 | NuclAT_23 | - | - |
| - | 3214121..3214177 | - | 57 | NuclAT_23 | - | - |
| - | 3214121..3214177 | - | 57 | NuclAT_23 | - | - |
| - | 3214121..3214177 | - | 57 | NuclAT_26 | - | - |
| - | 3214121..3214177 | - | 57 | NuclAT_26 | - | - |
| - | 3214121..3214177 | - | 57 | NuclAT_26 | - | - |
| - | 3214121..3214177 | - | 57 | NuclAT_26 | - | - |
| - | 3214123..3214177 | - | 55 | NuclAT_29 | - | - |
| - | 3214123..3214177 | - | 55 | NuclAT_29 | - | - |
| - | 3214123..3214177 | - | 55 | NuclAT_29 | - | - |
| - | 3214123..3214177 | - | 55 | NuclAT_29 | - | - |
| - | 3214123..3214177 | - | 55 | NuclAT_32 | - | - |
| - | 3214123..3214177 | - | 55 | NuclAT_32 | - | - |
| - | 3214123..3214177 | - | 55 | NuclAT_32 | - | - |
| - | 3214123..3214177 | - | 55 | NuclAT_32 | - | - |
| - | 3214123..3214177 | - | 55 | NuclAT_35 | - | - |
| - | 3214123..3214177 | - | 55 | NuclAT_35 | - | - |
| - | 3214123..3214177 | - | 55 | NuclAT_35 | - | - |
| - | 3214123..3214177 | - | 55 | NuclAT_35 | - | - |
| - | 3214123..3214177 | - | 55 | NuclAT_38 | - | - |
| - | 3214123..3214177 | - | 55 | NuclAT_38 | - | - |
| - | 3214123..3214177 | - | 55 | NuclAT_38 | - | - |
| - | 3214123..3214177 | - | 55 | NuclAT_38 | - | - |
| C1P84_RS16590 | 3214235..3214342 | + | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | - |
| - | 3214604..3214661 | - | 58 | NuclAT_24 | - | - |
| - | 3214604..3214661 | - | 58 | NuclAT_24 | - | - |
| - | 3214604..3214661 | - | 58 | NuclAT_24 | - | - |
| - | 3214604..3214661 | - | 58 | NuclAT_24 | - | - |
| - | 3214604..3214661 | - | 58 | NuclAT_27 | - | - |
| - | 3214604..3214661 | - | 58 | NuclAT_27 | - | - |
| - | 3214604..3214661 | - | 58 | NuclAT_27 | - | - |
| - | 3214604..3214661 | - | 58 | NuclAT_27 | - | - |
| - | 3214606..3214661 | - | 56 | NuclAT_30 | - | - |
| - | 3214606..3214661 | - | 56 | NuclAT_30 | - | - |
| - | 3214606..3214661 | - | 56 | NuclAT_30 | - | - |
| - | 3214606..3214661 | - | 56 | NuclAT_30 | - | - |
| - | 3214606..3214661 | - | 56 | NuclAT_33 | - | - |
| - | 3214606..3214661 | - | 56 | NuclAT_33 | - | - |
| - | 3214606..3214661 | - | 56 | NuclAT_33 | - | - |
| - | 3214606..3214661 | - | 56 | NuclAT_33 | - | - |
| - | 3214606..3214661 | - | 56 | NuclAT_36 | - | - |
| - | 3214606..3214661 | - | 56 | NuclAT_36 | - | - |
| - | 3214606..3214661 | - | 56 | NuclAT_36 | - | - |
| - | 3214606..3214661 | - | 56 | NuclAT_36 | - | - |
| - | 3214606..3214661 | - | 56 | NuclAT_39 | - | - |
| - | 3214606..3214661 | - | 56 | NuclAT_39 | - | - |
| - | 3214606..3214661 | - | 56 | NuclAT_39 | - | - |
| - | 3214606..3214661 | - | 56 | NuclAT_39 | - | - |
| C1P84_RS16600 | 3214718..3214825 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 3215087..3215144 | - | 58 | NuclAT_22 | - | - |
| - | 3215087..3215144 | - | 58 | NuclAT_22 | - | - |
| - | 3215087..3215144 | - | 58 | NuclAT_22 | - | - |
| - | 3215087..3215144 | - | 58 | NuclAT_22 | - | - |
| - | 3215087..3215144 | - | 58 | NuclAT_25 | - | - |
| - | 3215087..3215144 | - | 58 | NuclAT_25 | - | - |
| - | 3215087..3215144 | - | 58 | NuclAT_25 | - | - |
| - | 3215087..3215144 | - | 58 | NuclAT_25 | - | - |
| - | 3215089..3215144 | - | 56 | NuclAT_28 | - | - |
| - | 3215089..3215144 | - | 56 | NuclAT_28 | - | - |
| - | 3215089..3215144 | - | 56 | NuclAT_28 | - | - |
| - | 3215089..3215144 | - | 56 | NuclAT_28 | - | - |
| - | 3215089..3215144 | - | 56 | NuclAT_31 | - | - |
| - | 3215089..3215144 | - | 56 | NuclAT_31 | - | - |
| - | 3215089..3215144 | - | 56 | NuclAT_31 | - | - |
| - | 3215089..3215144 | - | 56 | NuclAT_31 | - | - |
| - | 3215089..3215144 | - | 56 | NuclAT_34 | - | - |
| - | 3215089..3215144 | - | 56 | NuclAT_34 | - | - |
| - | 3215089..3215144 | - | 56 | NuclAT_34 | - | - |
| - | 3215089..3215144 | - | 56 | NuclAT_34 | - | - |
| - | 3215089..3215144 | - | 56 | NuclAT_37 | - | - |
| - | 3215089..3215144 | - | 56 | NuclAT_37 | - | - |
| - | 3215089..3215144 | - | 56 | NuclAT_37 | - | - |
| - | 3215089..3215144 | - | 56 | NuclAT_37 | - | - |
| C1P84_RS16610 | 3215201..3215308 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| C1P84_RS16615 | 3215395..3217074 | - | 1680 | WP_000191557.1 | cellulose biosynthesis protein BcsG | - |
| C1P84_RS16620 | 3217071..3217262 | - | 192 | WP_000988299.1 | cellulose biosynthesis protein BcsF | - |
| C1P84_RS16625 | 3217259..3218830 | - | 1572 | WP_001204920.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T95822 WP_001295224.1 NZ_CP026776:3213752-3213859 [Shigella flexneri]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T95822 NZ_CP026776:3213752-3213859 [Shigella flexneri]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAG
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAG
Antitoxin
Download Length: 67 bp
>AT95822 NZ_CP026776:c3213703-3213637 [Shigella flexneri]
GTCTAGGTTCAAGATTAGCCCCCGTTATGTTGTCAGGTACATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTTATGTTGTCAGGTACATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|