Detailed information of TA system TA095822

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 3213637..3213859
• Replicon: chromosome
• Accession: NZ_CP026776
• Organism: Shigella flexneri strain 98-3193

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: S1NWX0
• Locus tag: C1P84_RS16580
• Protein ID: WP_001295224.1
• Coordinates: 3213752..3213859 (+)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	3213637..3213703 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
C1P84_RS16560	3209078..3209980	+	903	WP_000084666.1	dipeptide ABC transporter permease DppC	-
C1P84_RS16565	3209991..3210974	+	984	WP_001196486.1	dipeptide ABC transporter ATP-binding protein	-
C1P84_RS16570	3210971..3211975	+	1005	WP_000107041.1	dipeptide ABC transporter ATP-binding subunit DppF	-
C1P84_RS16575	3212005..3213276	-	1272	WP_005052340.1	aromatic amino acid transport family protein	-
-	3213637..3213703	-	67	-	-	Antitoxin
C1P84_RS16580	3213752..3213859	+	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	3214121..3214177	-	57	NuclAT_23	-	-
-	3214121..3214177	-	57	NuclAT_23	-	-
-	3214121..3214177	-	57	NuclAT_23	-	-
-	3214121..3214177	-	57	NuclAT_23	-	-
-	3214121..3214177	-	57	NuclAT_26	-	-
-	3214121..3214177	-	57	NuclAT_26	-	-
-	3214121..3214177	-	57	NuclAT_26	-	-
-	3214121..3214177	-	57	NuclAT_26	-	-
-	3214123..3214177	-	55	NuclAT_29	-	-
-	3214123..3214177	-	55	NuclAT_29	-	-
-	3214123..3214177	-	55	NuclAT_29	-	-
-	3214123..3214177	-	55	NuclAT_29	-	-
-	3214123..3214177	-	55	NuclAT_32	-	-
-	3214123..3214177	-	55	NuclAT_32	-	-
-	3214123..3214177	-	55	NuclAT_32	-	-
-	3214123..3214177	-	55	NuclAT_32	-	-
-	3214123..3214177	-	55	NuclAT_35	-	-
-	3214123..3214177	-	55	NuclAT_35	-	-
-	3214123..3214177	-	55	NuclAT_35	-	-
-	3214123..3214177	-	55	NuclAT_35	-	-
-	3214123..3214177	-	55	NuclAT_38	-	-
-	3214123..3214177	-	55	NuclAT_38	-	-
-	3214123..3214177	-	55	NuclAT_38	-	-
-	3214123..3214177	-	55	NuclAT_38	-	-
C1P84_RS16590	3214235..3214342	+	108	WP_000141634.1	type I toxin-antitoxin system toxic polypeptide LdrD	-
-	3214604..3214661	-	58	NuclAT_24	-	-
-	3214604..3214661	-	58	NuclAT_24	-	-
-	3214604..3214661	-	58	NuclAT_24	-	-
-	3214604..3214661	-	58	NuclAT_24	-	-
-	3214604..3214661	-	58	NuclAT_27	-	-
-	3214604..3214661	-	58	NuclAT_27	-	-
-	3214604..3214661	-	58	NuclAT_27	-	-
-	3214604..3214661	-	58	NuclAT_27	-	-
-	3214606..3214661	-	56	NuclAT_30	-	-
-	3214606..3214661	-	56	NuclAT_30	-	-
-	3214606..3214661	-	56	NuclAT_30	-	-
-	3214606..3214661	-	56	NuclAT_30	-	-
-	3214606..3214661	-	56	NuclAT_33	-	-
-	3214606..3214661	-	56	NuclAT_33	-	-
-	3214606..3214661	-	56	NuclAT_33	-	-
-	3214606..3214661	-	56	NuclAT_33	-	-
-	3214606..3214661	-	56	NuclAT_36	-	-
-	3214606..3214661	-	56	NuclAT_36	-	-
-	3214606..3214661	-	56	NuclAT_36	-	-
-	3214606..3214661	-	56	NuclAT_36	-	-
-	3214606..3214661	-	56	NuclAT_39	-	-
-	3214606..3214661	-	56	NuclAT_39	-	-
-	3214606..3214661	-	56	NuclAT_39	-	-
-	3214606..3214661	-	56	NuclAT_39	-	-
C1P84_RS16600	3214718..3214825	+	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	3215087..3215144	-	58	NuclAT_22	-	-
-	3215087..3215144	-	58	NuclAT_22	-	-
-	3215087..3215144	-	58	NuclAT_22	-	-
-	3215087..3215144	-	58	NuclAT_22	-	-
-	3215087..3215144	-	58	NuclAT_25	-	-
-	3215087..3215144	-	58	NuclAT_25	-	-
-	3215087..3215144	-	58	NuclAT_25	-	-
-	3215087..3215144	-	58	NuclAT_25	-	-
-	3215089..3215144	-	56	NuclAT_28	-	-
-	3215089..3215144	-	56	NuclAT_28	-	-
-	3215089..3215144	-	56	NuclAT_28	-	-
-	3215089..3215144	-	56	NuclAT_28	-	-
-	3215089..3215144	-	56	NuclAT_31	-	-
-	3215089..3215144	-	56	NuclAT_31	-	-
-	3215089..3215144	-	56	NuclAT_31	-	-
-	3215089..3215144	-	56	NuclAT_31	-	-
-	3215089..3215144	-	56	NuclAT_34	-	-
-	3215089..3215144	-	56	NuclAT_34	-	-
-	3215089..3215144	-	56	NuclAT_34	-	-
-	3215089..3215144	-	56	NuclAT_34	-	-
-	3215089..3215144	-	56	NuclAT_37	-	-
-	3215089..3215144	-	56	NuclAT_37	-	-
-	3215089..3215144	-	56	NuclAT_37	-	-
-	3215089..3215144	-	56	NuclAT_37	-	-
C1P84_RS16610	3215201..3215308	+	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	-
C1P84_RS16615	3215395..3217074	-	1680	WP_000191557.1	cellulose biosynthesis protein BcsG	-
C1P84_RS16620	3217071..3217262	-	192	WP_000988299.1	cellulose biosynthesis protein BcsF	-
C1P84_RS16625	3217259..3218830	-	1572	WP_001204920.1	cellulose biosynthesis c-di-GMP-binding protein BcsE	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3882.70 Da
• Isoelectric Point: 9.0157

>T95822 WP_001295224.1 NZ_CP026776:3213752-3213859 [Shigella flexneri]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Nucleotide

• Length: 108 bp

>T95822 NZ_CP026776:3213752-3213859 [Shigella flexneri]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAG

Antitoxin

Nucleotide

• Length: 67 bp

>AT95822 NZ_CP026776:c3213703-3213637 [Shigella flexneri]
GTCTAGGTTCAAGATTAGCCCCCGTTATGTTGTCAGGTACATACCTGCAACGTGCGGGGGTTTTCTC

Structures

Toxin

• AlphaFold DB: A0A4P7TSJ7

Antitoxin