Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 903591..903816 | Replicon | chromosome |
| Accession | NZ_CP026776 | ||
| Organism | Shigella flexneri strain 98-3193 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | C1P84_RS04960 | Protein ID | WP_000813254.1 |
| Coordinates | 903591..903746 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 903758..903816 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P84_RS04920 | 898717..899199 | - | 483 | WP_000068107.1 | ORF6N domain-containing protein | - |
| C1P84_RS04930 | 900488..900661 | - | 174 | WP_000504450.1 | hypothetical protein | - |
| C1P84_RS04935 | 900814..901368 | - | 555 | WP_000640143.1 | DUF1133 family protein | - |
| C1P84_RS04940 | 901365..901655 | - | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
| C1P84_RS04945 | 901655..902254 | - | 600 | WP_000940329.1 | DUF1367 family protein | - |
| C1P84_RS04950 | 902388..903085 | + | 698 | WP_227804319.1 | IS1 family transposase | - |
| C1P84_RS04960 | 903591..903746 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 903758..903816 | + | 59 | - | - | Antitoxin |
| C1P84_RS04965 | 904201..904566 | - | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
| C1P84_RS04970 | 904566..905231 | - | 666 | WP_000208062.1 | hypothetical protein | - |
| C1P84_RS04975 | 905228..905593 | - | 366 | WP_001229298.1 | HNH endonuclease signature motif containing protein | - |
| C1P84_RS04980 | 905595..905813 | - | 219 | WP_000256998.1 | DUF4014 family protein | - |
| C1P84_RS04985 | 905906..906262 | - | 357 | WP_005048249.1 | hypothetical protein | - |
| C1P84_RS04990 | 906320..906742 | - | 423 | WP_001118167.1 | DUF977 family protein | - |
| C1P84_RS04995 | 906757..907500 | - | 744 | WP_000788999.1 | ATP-binding protein | - |
| C1P84_RS23615 | 907646..907815 | - | 170 | Protein_941 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ipaH9.8 | 874539..915397 | 40858 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T95814 WP_000813254.1 NZ_CP026776:c903746-903591 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T95814 NZ_CP026776:c903746-903591 [Shigella flexneri]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT95814 NZ_CP026776:903758-903816 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|