Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 267123..267348 | Replicon | chromosome |
| Accession | NZ_CP026776 | ||
| Organism | Shigella flexneri strain 98-3193 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | C1P84_RS01410 | Protein ID | WP_000813254.1 |
| Coordinates | 267193..267348 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 267123..267181 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P84_RS01365 | 262310..263572 | - | 1263 | Protein_258 | tyrosine-type recombinase/integrase | - |
| C1P84_RS01375 | 263910..264707 | - | 798 | WP_024260703.1 | DgsA anti-repressor MtfA | - |
| C1P84_RS01385 | 264918..265958 | - | 1041 | WP_005096324.1 | tyrosine-type recombinase/integrase | - |
| C1P84_RS01390 | 265958..266098 | - | 141 | Protein_261 | DUF4224 domain-containing protein | - |
| C1P84_RS01395 | 266125..266541 | + | 417 | WP_005069274.1 | hypothetical protein | - |
| - | 267123..267181 | - | 59 | - | - | Antitoxin |
| C1P84_RS01410 | 267193..267348 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| C1P84_RS01420 | 267516..267794 | + | 279 | WP_011069426.1 | hypothetical protein | - |
| C1P84_RS01425 | 267796..268854 | + | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
| C1P84_RS01430 | 268855..269220 | + | 366 | WP_000140017.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C1P84_RS01435 | 269217..269905 | + | 689 | Protein_267 | bacteriophage antitermination protein Q | - |
| C1P84_RS01465 | 270701..270916 | + | 216 | WP_000839572.1 | class II holin family protein | - |
| C1P84_RS01470 | 271015..271689 | + | 675 | WP_004967157.1 | IS66-like element accessory protein TnpA | - |
| C1P84_RS01475 | 271686..272036 | + | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ipaH9.8 | 231694..293618 | 61924 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T95803 WP_000813254.1 NZ_CP026776:267193-267348 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T95803 NZ_CP026776:267193-267348 [Shigella flexneri]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT95803 NZ_CP026776:c267181-267123 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|