Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1029629..1029854 | Replicon | chromosome |
| Accession | NZ_CP026768 | ||
| Organism | Shigella flexneri Y strain 93-3063 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | C1P87_RS05535 | Protein ID | WP_000813254.1 |
| Coordinates | 1029629..1029784 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1029796..1029854 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P87_RS05495 | 1024755..1025237 | - | 483 | WP_000068107.1 | ORF6N domain-containing protein | - |
| C1P87_RS05505 | 1026526..1026711 | - | 186 | WP_005049799.1 | hypothetical protein | - |
| C1P87_RS05510 | 1026852..1027406 | - | 555 | WP_000640143.1 | DUF1133 family protein | - |
| C1P87_RS05515 | 1027403..1027693 | - | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
| C1P87_RS05520 | 1027693..1028292 | - | 600 | WP_000940329.1 | DUF1367 family protein | - |
| C1P87_RS26065 | 1028195..1028527 | - | 333 | WP_171764399.1 | hypothetical protein | - |
| C1P87_RS05525 | 1028426..1029123 | + | 698 | WP_252988570.1 | IS1 family transposase | - |
| C1P87_RS05535 | 1029629..1029784 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 1029796..1029854 | + | 59 | - | - | Antitoxin |
| C1P87_RS05540 | 1030239..1030604 | - | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
| C1P87_RS05545 | 1030604..1031269 | - | 666 | WP_000208062.1 | hypothetical protein | - |
| C1P87_RS05550 | 1031266..1031631 | - | 366 | WP_001229298.1 | HNH endonuclease signature motif containing protein | - |
| C1P87_RS05555 | 1031633..1031851 | - | 219 | WP_000256998.1 | DUF4014 family protein | - |
| C1P87_RS05560 | 1031944..1032300 | - | 357 | WP_005048249.1 | hypothetical protein | - |
| C1P87_RS05570 | 1033625..1034047 | - | 423 | WP_001118167.1 | DUF977 family protein | - |
| C1P87_RS05575 | 1034062..1034808 | - | 747 | WP_128861108.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | sitABCD | ipaH9.8 | 977677..1040367 | 62690 | |
| - | inside | IScluster/Tn | sitABCD | - | 1002779..1037882 | 35103 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T95768 WP_000813254.1 NZ_CP026768:c1029784-1029629 [Shigella flexneri Y]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T95768 NZ_CP026768:c1029784-1029629 [Shigella flexneri Y]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT95768 NZ_CP026768:1029796-1029854 [Shigella flexneri Y]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|