Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 368624..368849 | Replicon | chromosome |
| Accession | NZ_CP026768 | ||
| Organism | Shigella flexneri Y strain 93-3063 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | C1P87_RS01810 | Protein ID | WP_000813254.1 |
| Coordinates | 368694..368849 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 368624..368682 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P87_RS01765 | 363801..365063 | - | 1263 | Protein_342 | tyrosine-type recombinase/integrase | - |
| C1P87_RS01775 | 365401..366198 | - | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
| C1P87_RS01785 | 366409..367459 | - | 1051 | Protein_344 | tyrosine-type recombinase/integrase | - |
| C1P87_RS01790 | 367459..367599 | - | 141 | Protein_345 | DUF4224 domain-containing protein | - |
| C1P87_RS01795 | 367626..368042 | + | 417 | WP_005069274.1 | hypothetical protein | - |
| - | 368624..368682 | - | 59 | - | - | Antitoxin |
| C1P87_RS01810 | 368694..368849 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| C1P87_RS01820 | 369017..369295 | + | 279 | WP_011069426.1 | hypothetical protein | - |
| C1P87_RS01825 | 369297..370355 | + | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
| C1P87_RS01830 | 370356..370721 | + | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C1P87_RS01835 | 370718..371406 | + | 689 | Protein_351 | bacteriophage antitermination protein Q | - |
| C1P87_RS01865 | 372202..372417 | + | 216 | WP_000839572.1 | class II holin family protein | - |
| C1P87_RS01870 | 372516..372707 | + | 192 | Protein_353 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ipaH9.8 | 327064..391030 | 63966 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T95757 WP_000813254.1 NZ_CP026768:368694-368849 [Shigella flexneri Y]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T95757 NZ_CP026768:368694-368849 [Shigella flexneri Y]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT95757 NZ_CP026768:c368682-368624 [Shigella flexneri Y]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|