Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4274917..4275142 | Replicon | chromosome |
| Accession | NZ_CP026766 | ||
| Organism | Shigella boydii strain 59-248 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | C1P58_RS22040 | Protein ID | WP_000813254.1 |
| Coordinates | 4274917..4275072 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 4275084..4275142 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P58_RS21995 | 4270211..4270417 | - | 207 | Protein_4170 | integrase | - |
| C1P58_RS26400 | 4270407..4270487 | - | 81 | Protein_4171 | tail fiber assembly protein | - |
| C1P58_RS26275 | 4270490..4271011 | - | 522 | WP_192940938.1 | hypothetical protein | - |
| C1P58_RS26280 | 4271032..4271697 | - | 666 | WP_004981765.1 | hypothetical protein | - |
| C1P58_RS22005 | 4271684..4272274 | - | 591 | WP_073691607.1 | DUF2313 domain-containing protein | - |
| C1P58_RS22010 | 4272274..4272432 | - | 159 | WP_000281422.1 | hypothetical protein | - |
| C1P58_RS22015 | 4272514..4273670 | + | 1157 | WP_094096479.1 | IS3 family transposase | - |
| C1P58_RS22025 | 4273714..4274469 | - | 756 | Protein_4177 | DUF968 domain-containing protein | - |
| C1P58_RS22030 | 4274471..4274749 | - | 279 | WP_000929754.1 | hypothetical protein | - |
| C1P58_RS22040 | 4274917..4275072 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 4275084..4275142 | + | 59 | - | - | Antitoxin |
| C1P58_RS22055 | 4275724..4276140 | - | 417 | WP_005069274.1 | hypothetical protein | - |
| C1P58_RS22060 | 4276237..4276692 | - | 456 | WP_000335373.1 | ead/Ea22-like family protein | - |
| C1P58_RS22065 | 4276679..4276984 | - | 306 | WP_001266147.1 | DUF4406 domain-containing protein | - |
| C1P58_RS22070 | 4276981..4277403 | - | 423 | WP_134802472.1 | DUF977 family protein | - |
| C1P58_RS22075 | 4277444..4278514 | - | 1071 | WP_001262382.1 | hypothetical protein | - |
| C1P58_RS22080 | 4278586..4279011 | - | 426 | WP_000693847.1 | Rha family transcriptional regulator | - |
| C1P58_RS22085 | 4279008..4279262 | - | 255 | WP_001072337.1 | hypothetical protein | - |
| C1P58_RS22090 | 4279342..4279761 | + | 420 | WP_000233320.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4245770..4298187 | 52417 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T95742 WP_000813254.1 NZ_CP026766:c4275072-4274917 [Shigella boydii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T95742 NZ_CP026766:c4275072-4274917 [Shigella boydii]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT95742 NZ_CP026766:4275084-4275142 [Shigella boydii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|