Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 449389..449614 | Replicon | chromosome |
| Accession | NZ_CP026766 | ||
| Organism | Shigella boydii strain 59-248 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | C1P58_RS02455 | Protein ID | WP_000813254.1 |
| Coordinates | 449389..449544 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 449556..449614 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P58_RS02420 | 444692..445750 | - | 1059 | WP_134802271.1 | site-specific DNA-methyltransferase | - |
| C1P58_RS02425 | 445858..446098 | - | 241 | Protein_459 | hypothetical protein | - |
| C1P58_RS02430 | 446323..447144 | - | 822 | WP_000762880.1 | antitermination protein | - |
| C1P58_RS02435 | 447141..447515 | - | 375 | WP_000904114.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C1P58_RS02440 | 447528..448574 | - | 1047 | WP_073691454.1 | DUF968 domain-containing protein | - |
| C1P58_RS02445 | 448576..448854 | - | 279 | WP_001515373.1 | hypothetical protein | - |
| C1P58_RS02450 | 448921..449172 | - | 252 | WP_000980987.1 | hypothetical protein | - |
| C1P58_RS02455 | 449389..449544 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 449556..449614 | + | 59 | - | - | Antitoxin |
| C1P58_RS02470 | 450287..450982 | + | 696 | WP_073832089.1 | hypothetical protein | - |
| C1P58_RS02475 | 450995..451648 | + | 654 | WP_077897731.1 | class I SAM-dependent methyltransferase | - |
| C1P58_RS02480 | 451964..452864 | - | 901 | Protein_468 | SMEK domain-containing protein | - |
| C1P58_RS02485 | 453117..453539 | - | 423 | WP_001151218.1 | DUF977 family protein | - |
| C1P58_RS02490 | 453580..454545 | - | 966 | WP_000054487.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 410089..469403 | 59314 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T95734 WP_000813254.1 NZ_CP026766:c449544-449389 [Shigella boydii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T95734 NZ_CP026766:c449544-449389 [Shigella boydii]
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT95734 NZ_CP026766:449556-449614 [Shigella boydii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|