Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2372532..2372757 | Replicon | chromosome |
| Accession | NZ_CP026765 | ||
| Organism | Shigella flexneri strain 04-3145 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | C1P85_RS12830 | Protein ID | WP_000813254.1 |
| Coordinates | 2372532..2372687 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2372699..2372757 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P85_RS12765 | 2367965..2368662 | + | 698 | WP_225620329.1 | IS1 family transposase | - |
| C1P85_RS12770 | 2368674..2368865 | - | 192 | Protein_2398 | helix-turn-helix domain-containing protein | - |
| C1P85_RS12775 | 2368964..2369179 | - | 216 | WP_000839572.1 | class II holin family protein | - |
| C1P85_RS12805 | 2369975..2370663 | - | 689 | Protein_2400 | bacteriophage antitermination protein Q | - |
| C1P85_RS12810 | 2370660..2371025 | - | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C1P85_RS12815 | 2371026..2372084 | - | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
| C1P85_RS12820 | 2372086..2372364 | - | 279 | WP_011069426.1 | hypothetical protein | - |
| C1P85_RS12830 | 2372532..2372687 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2372699..2372757 | + | 59 | - | - | Antitoxin |
| C1P85_RS12845 | 2373339..2373755 | - | 417 | WP_005069274.1 | hypothetical protein | - |
| C1P85_RS12850 | 2373782..2373922 | + | 141 | Protein_2406 | DUF4224 domain-containing protein | - |
| C1P85_RS12855 | 2373922..2374972 | + | 1051 | Protein_2407 | tyrosine-type recombinase/integrase | - |
| C1P85_RS12865 | 2375183..2375980 | + | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
| C1P85_RS12875 | 2376318..2377580 | + | 1263 | Protein_2409 | tyrosine-type recombinase/integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ipaH9.8 | 2350352..2409840 | 59488 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T95729 WP_000813254.1 NZ_CP026765:c2372687-2372532 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T95729 NZ_CP026765:c2372687-2372532 [Shigella flexneri]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT95729 NZ_CP026765:2372699-2372757 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|