Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1713499..1713724 | Replicon | chromosome |
| Accession | NZ_CP026765 | ||
| Organism | Shigella flexneri strain 04-3145 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | C1P85_RS09140 | Protein ID | WP_000813254.1 |
| Coordinates | 1713569..1713724 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1713499..1713557 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P85_RS24350 | 1709497..1709666 | + | 170 | Protein_1694 | hypothetical protein | - |
| C1P85_RS09105 | 1709812..1710558 | + | 747 | WP_000788996.1 | ATP-binding protein | - |
| C1P85_RS09110 | 1710573..1710995 | + | 423 | WP_001118167.1 | DUF977 family protein | - |
| C1P85_RS09115 | 1711053..1711409 | + | 357 | WP_005048249.1 | hypothetical protein | - |
| C1P85_RS09120 | 1711502..1711720 | + | 219 | WP_000256998.1 | DUF4014 family protein | - |
| C1P85_RS09125 | 1711722..1712087 | + | 366 | WP_001229298.1 | HNH endonuclease signature motif containing protein | - |
| C1P85_RS09130 | 1712084..1712749 | + | 666 | WP_000208062.1 | hypothetical protein | - |
| C1P85_RS09135 | 1712749..1713114 | + | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
| - | 1713499..1713557 | - | 59 | - | - | Antitoxin |
| C1P85_RS09140 | 1713569..1713724 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| C1P85_RS09155 | 1715061..1715660 | + | 600 | WP_000940329.1 | DUF1367 family protein | - |
| C1P85_RS09160 | 1715660..1715950 | + | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
| C1P85_RS09165 | 1715947..1716501 | + | 555 | WP_000640143.1 | DUF1133 family protein | - |
| C1P85_RS09170 | 1716654..1716827 | + | 174 | WP_000504450.1 | hypothetical protein | - |
| C1P85_RS09175 | 1716889..1718045 | + | 1157 | WP_134797302.1 | IS3-like element IS600 family transposase | - |
| C1P85_RS09180 | 1718038..1718598 | + | 561 | WP_072075205.1 | ORF6N domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | sitABCD | ipaH9.8 | 1704253..1766445 | 62192 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T95718 WP_000813254.1 NZ_CP026765:1713569-1713724 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T95718 NZ_CP026765:1713569-1713724 [Shigella flexneri]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT95718 NZ_CP026765:c1713557-1713499 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|