Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 914955..915176 | Replicon | chromosome |
Accession | NZ_CP026762 | ||
Organism | Shigella boydii strain NCTC 9850 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1PGT3 |
Locus tag | C1P50_RS05180 | Protein ID | WP_000170954.1 |
Coordinates | 914955..915062 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 915110..915176 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1P50_RS05155 | 910798..911880 | + | 1083 | WP_000804740.1 | peptide chain release factor 1 | - |
C1P50_RS05160 | 911880..912713 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
C1P50_RS05165 | 912710..913102 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
C1P50_RS05170 | 913106..913916 | + | 811 | Protein_950 | tetratricopeptide repeat-containing protein | - |
C1P50_RS05175 | 913952..914806 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
C1P50_RS05180 | 914955..915062 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 915110..915176 | + | 67 | NuclAT_39 | - | Antitoxin |
- | 915110..915176 | + | 67 | NuclAT_39 | - | Antitoxin |
- | 915110..915176 | + | 67 | NuclAT_39 | - | Antitoxin |
- | 915110..915176 | + | 67 | NuclAT_39 | - | Antitoxin |
- | 915110..915176 | + | 67 | NuclAT_41 | - | Antitoxin |
- | 915110..915176 | + | 67 | NuclAT_41 | - | Antitoxin |
- | 915110..915176 | + | 67 | NuclAT_41 | - | Antitoxin |
- | 915110..915176 | + | 67 | NuclAT_41 | - | Antitoxin |
- | 915110..915176 | + | 67 | NuclAT_43 | - | Antitoxin |
- | 915110..915176 | + | 67 | NuclAT_43 | - | Antitoxin |
- | 915110..915176 | + | 67 | NuclAT_43 | - | Antitoxin |
- | 915110..915176 | + | 67 | NuclAT_43 | - | Antitoxin |
C1P50_RS05185 | 915490..915597 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 915650..915711 | + | 62 | NuclAT_27 | - | - |
- | 915650..915711 | + | 62 | NuclAT_27 | - | - |
- | 915650..915711 | + | 62 | NuclAT_27 | - | - |
- | 915650..915711 | + | 62 | NuclAT_27 | - | - |
- | 915650..915711 | + | 62 | NuclAT_29 | - | - |
- | 915650..915711 | + | 62 | NuclAT_29 | - | - |
- | 915650..915711 | + | 62 | NuclAT_29 | - | - |
- | 915650..915711 | + | 62 | NuclAT_29 | - | - |
- | 915650..915711 | + | 62 | NuclAT_31 | - | - |
- | 915650..915711 | + | 62 | NuclAT_31 | - | - |
- | 915650..915711 | + | 62 | NuclAT_31 | - | - |
- | 915650..915711 | + | 62 | NuclAT_31 | - | - |
- | 915650..915711 | + | 62 | NuclAT_33 | - | - |
- | 915650..915711 | + | 62 | NuclAT_33 | - | - |
- | 915650..915711 | + | 62 | NuclAT_33 | - | - |
- | 915650..915711 | + | 62 | NuclAT_33 | - | - |
- | 915650..915711 | + | 62 | NuclAT_35 | - | - |
- | 915650..915711 | + | 62 | NuclAT_35 | - | - |
- | 915650..915711 | + | 62 | NuclAT_35 | - | - |
- | 915650..915711 | + | 62 | NuclAT_35 | - | - |
- | 915650..915711 | + | 62 | NuclAT_37 | - | - |
- | 915650..915711 | + | 62 | NuclAT_37 | - | - |
- | 915650..915711 | + | 62 | NuclAT_37 | - | - |
- | 915650..915711 | + | 62 | NuclAT_37 | - | - |
- | 915650..915712 | + | 63 | NuclAT_38 | - | - |
- | 915650..915712 | + | 63 | NuclAT_38 | - | - |
- | 915650..915712 | + | 63 | NuclAT_38 | - | - |
- | 915650..915712 | + | 63 | NuclAT_38 | - | - |
- | 915650..915712 | + | 63 | NuclAT_40 | - | - |
- | 915650..915712 | + | 63 | NuclAT_40 | - | - |
- | 915650..915712 | + | 63 | NuclAT_40 | - | - |
- | 915650..915712 | + | 63 | NuclAT_40 | - | - |
- | 915650..915712 | + | 63 | NuclAT_42 | - | - |
- | 915650..915712 | + | 63 | NuclAT_42 | - | - |
- | 915650..915712 | + | 63 | NuclAT_42 | - | - |
- | 915650..915712 | + | 63 | NuclAT_42 | - | - |
- | 915650..915713 | + | 64 | NuclAT_15 | - | - |
- | 915650..915713 | + | 64 | NuclAT_15 | - | - |
- | 915650..915713 | + | 64 | NuclAT_15 | - | - |
- | 915650..915713 | + | 64 | NuclAT_15 | - | - |
- | 915650..915713 | + | 64 | NuclAT_17 | - | - |
- | 915650..915713 | + | 64 | NuclAT_17 | - | - |
- | 915650..915713 | + | 64 | NuclAT_17 | - | - |
- | 915650..915713 | + | 64 | NuclAT_17 | - | - |
- | 915650..915713 | + | 64 | NuclAT_19 | - | - |
- | 915650..915713 | + | 64 | NuclAT_19 | - | - |
- | 915650..915713 | + | 64 | NuclAT_19 | - | - |
- | 915650..915713 | + | 64 | NuclAT_19 | - | - |
- | 915650..915713 | + | 64 | NuclAT_21 | - | - |
- | 915650..915713 | + | 64 | NuclAT_21 | - | - |
- | 915650..915713 | + | 64 | NuclAT_21 | - | - |
- | 915650..915713 | + | 64 | NuclAT_21 | - | - |
- | 915650..915713 | + | 64 | NuclAT_23 | - | - |
- | 915650..915713 | + | 64 | NuclAT_23 | - | - |
- | 915650..915713 | + | 64 | NuclAT_23 | - | - |
- | 915650..915713 | + | 64 | NuclAT_23 | - | - |
- | 915650..915713 | + | 64 | NuclAT_25 | - | - |
- | 915650..915713 | + | 64 | NuclAT_25 | - | - |
- | 915650..915713 | + | 64 | NuclAT_25 | - | - |
- | 915650..915713 | + | 64 | NuclAT_25 | - | - |
C1P50_RS05190 | 916026..916133 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 916181..916246 | + | 66 | NuclAT_26 | - | - |
- | 916181..916246 | + | 66 | NuclAT_26 | - | - |
- | 916181..916246 | + | 66 | NuclAT_26 | - | - |
- | 916181..916246 | + | 66 | NuclAT_26 | - | - |
- | 916181..916246 | + | 66 | NuclAT_28 | - | - |
- | 916181..916246 | + | 66 | NuclAT_28 | - | - |
- | 916181..916246 | + | 66 | NuclAT_28 | - | - |
- | 916181..916246 | + | 66 | NuclAT_28 | - | - |
- | 916181..916246 | + | 66 | NuclAT_30 | - | - |
- | 916181..916246 | + | 66 | NuclAT_30 | - | - |
- | 916181..916246 | + | 66 | NuclAT_30 | - | - |
- | 916181..916246 | + | 66 | NuclAT_30 | - | - |
- | 916181..916246 | + | 66 | NuclAT_32 | - | - |
- | 916181..916246 | + | 66 | NuclAT_32 | - | - |
- | 916181..916246 | + | 66 | NuclAT_32 | - | - |
- | 916181..916246 | + | 66 | NuclAT_32 | - | - |
- | 916181..916246 | + | 66 | NuclAT_34 | - | - |
- | 916181..916246 | + | 66 | NuclAT_34 | - | - |
- | 916181..916246 | + | 66 | NuclAT_34 | - | - |
- | 916181..916246 | + | 66 | NuclAT_34 | - | - |
- | 916181..916246 | + | 66 | NuclAT_36 | - | - |
- | 916181..916246 | + | 66 | NuclAT_36 | - | - |
- | 916181..916246 | + | 66 | NuclAT_36 | - | - |
- | 916181..916246 | + | 66 | NuclAT_36 | - | - |
- | 916181..916248 | + | 68 | NuclAT_14 | - | - |
- | 916181..916248 | + | 68 | NuclAT_14 | - | - |
- | 916181..916248 | + | 68 | NuclAT_14 | - | - |
- | 916181..916248 | + | 68 | NuclAT_14 | - | - |
- | 916181..916248 | + | 68 | NuclAT_16 | - | - |
- | 916181..916248 | + | 68 | NuclAT_16 | - | - |
- | 916181..916248 | + | 68 | NuclAT_16 | - | - |
- | 916181..916248 | + | 68 | NuclAT_16 | - | - |
- | 916181..916248 | + | 68 | NuclAT_18 | - | - |
- | 916181..916248 | + | 68 | NuclAT_18 | - | - |
- | 916181..916248 | + | 68 | NuclAT_18 | - | - |
- | 916181..916248 | + | 68 | NuclAT_18 | - | - |
- | 916181..916248 | + | 68 | NuclAT_20 | - | - |
- | 916181..916248 | + | 68 | NuclAT_20 | - | - |
- | 916181..916248 | + | 68 | NuclAT_20 | - | - |
- | 916181..916248 | + | 68 | NuclAT_20 | - | - |
- | 916181..916248 | + | 68 | NuclAT_22 | - | - |
- | 916181..916248 | + | 68 | NuclAT_22 | - | - |
- | 916181..916248 | + | 68 | NuclAT_22 | - | - |
- | 916181..916248 | + | 68 | NuclAT_22 | - | - |
- | 916181..916248 | + | 68 | NuclAT_24 | - | - |
- | 916181..916248 | + | 68 | NuclAT_24 | - | - |
- | 916181..916248 | + | 68 | NuclAT_24 | - | - |
- | 916181..916248 | + | 68 | NuclAT_24 | - | - |
C1P50_RS05195 | 916537..917637 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
C1P50_RS05200 | 917907..918137 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
C1P50_RS05205 | 918295..918990 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
C1P50_RS05210 | 919034..919387 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T95697 WP_000170954.1 NZ_CP026762:c915062-914955 [Shigella boydii]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T95697 NZ_CP026762:c915062-914955 [Shigella boydii]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT95697 NZ_CP026762:915110-915176 [Shigella boydii]
GTTCTGGTTCAAGATTAGCCCCCGTTCTATTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTATTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|