Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 591511..591736 | Replicon | chromosome |
| Accession | NZ_CP026762 | ||
| Organism | Shigella boydii strain NCTC 9850 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | C1P50_RS03215 | Protein ID | WP_000813254.1 |
| Coordinates | 591511..591666 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 591678..591736 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P50_RS03180 | 586678..588216 | - | 1539 | Protein_579 | IS66-like element ISEc22 family transposase | - |
| C1P50_RS03185 | 588265..588612 | - | 348 | WP_000612626.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| C1P50_RS03190 | 588609..588989 | - | 381 | WP_001333468.1 | IS66 family insertion sequence hypothetical protein | - |
| C1P50_RS03195 | 589344..590471 | - | 1128 | WP_001063816.1 | IS110-like element ISSso6 family transposase | - |
| C1P50_RS03200 | 590602..591063 | - | 462 | Protein_583 | hypothetical protein | - |
| C1P50_RS03205 | 591065..591343 | - | 279 | WP_000929754.1 | hypothetical protein | - |
| C1P50_RS03215 | 591511..591666 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 591678..591736 | + | 59 | - | - | Antitoxin |
| C1P50_RS03230 | 592318..592760 | - | 443 | Protein_586 | hypothetical protein | - |
| C1P50_RS03235 | 592804..593184 | + | 381 | WP_001333468.1 | IS66 family insertion sequence hypothetical protein | - |
| C1P50_RS03240 | 593181..593528 | + | 348 | WP_000612626.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| C1P50_RS03245 | 593577..595115 | + | 1539 | WP_134795351.1 | IS66-like element ISEc22 family transposase | - |
| C1P50_RS03250 | 595112..595471 | + | 360 | WP_073692993.1 | 3'-5' exoribonuclease | - |
| C1P50_RS03255 | 595530..595733 | + | 204 | WP_000096344.1 | DUF4224 domain-containing protein | - |
| C1P50_RS03260 | 595733..596088 | + | 356 | Protein_592 | integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | ipaH9.8 | 583615..606756 | 23141 | |
| - | inside | IScluster/Tn | - | - | 584314..599392 | 15078 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T95693 WP_000813254.1 NZ_CP026762:c591666-591511 [Shigella boydii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T95693 NZ_CP026762:c591666-591511 [Shigella boydii]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT95693 NZ_CP026762:591678-591736 [Shigella boydii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|