Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-agrB/Ldr(toxin) |
| Location | 1143438..1143659 | Replicon | chromosome |
| Accession | NZ_CP026755 | ||
| Organism | Escherichia coli strain AR_0077 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A229AEQ8 |
| Locus tag | AM456_RS06760 | Protein ID | WP_000176713.1 |
| Coordinates | 1143438..1143545 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | agrB | ||
| Locus tag | - | ||
| Coordinates | 1143593..1143659 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AM456_RS06735 | 1139282..1140364 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| AM456_RS06740 | 1140364..1141197 | + | 834 | WP_032171150.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| AM456_RS06745 | 1141194..1141586 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| AM456_RS06750 | 1141590..1142399 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| AM456_RS06755 | 1142435..1143289 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| AM456_RS06760 | 1143438..1143545 | - | 108 | WP_000176713.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1143593..1143659 | + | 67 | NuclAT_10 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_10 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_10 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_10 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_12 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_12 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_12 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_12 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1143593..1143659 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1143595..1143658 | + | 64 | NuclAT_41 | - | - |
| - | 1143595..1143658 | + | 64 | NuclAT_41 | - | - |
| - | 1143595..1143658 | + | 64 | NuclAT_41 | - | - |
| - | 1143595..1143658 | + | 64 | NuclAT_41 | - | - |
| - | 1143595..1143658 | + | 64 | NuclAT_43 | - | - |
| - | 1143595..1143658 | + | 64 | NuclAT_43 | - | - |
| - | 1143595..1143658 | + | 64 | NuclAT_43 | - | - |
| - | 1143595..1143658 | + | 64 | NuclAT_43 | - | - |
| - | 1143595..1143658 | + | 64 | NuclAT_45 | - | - |
| - | 1143595..1143658 | + | 64 | NuclAT_45 | - | - |
| - | 1143595..1143658 | + | 64 | NuclAT_45 | - | - |
| - | 1143595..1143658 | + | 64 | NuclAT_45 | - | - |
| - | 1143595..1143658 | + | 64 | NuclAT_47 | - | - |
| - | 1143595..1143658 | + | 64 | NuclAT_47 | - | - |
| - | 1143595..1143658 | + | 64 | NuclAT_47 | - | - |
| - | 1143595..1143658 | + | 64 | NuclAT_47 | - | - |
| - | 1143595..1143658 | + | 64 | NuclAT_49 | - | - |
| - | 1143595..1143658 | + | 64 | NuclAT_49 | - | - |
| - | 1143595..1143658 | + | 64 | NuclAT_49 | - | - |
| - | 1143595..1143658 | + | 64 | NuclAT_49 | - | - |
| AM456_RS06765 | 1143973..1144080 | - | 108 | WP_000170956.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1144133..1144194 | + | 62 | NuclAT_40 | - | - |
| - | 1144133..1144194 | + | 62 | NuclAT_40 | - | - |
| - | 1144133..1144194 | + | 62 | NuclAT_40 | - | - |
| - | 1144133..1144194 | + | 62 | NuclAT_40 | - | - |
| - | 1144133..1144194 | + | 62 | NuclAT_42 | - | - |
| - | 1144133..1144194 | + | 62 | NuclAT_42 | - | - |
| - | 1144133..1144194 | + | 62 | NuclAT_42 | - | - |
| - | 1144133..1144194 | + | 62 | NuclAT_42 | - | - |
| - | 1144133..1144194 | + | 62 | NuclAT_44 | - | - |
| - | 1144133..1144194 | + | 62 | NuclAT_44 | - | - |
| - | 1144133..1144194 | + | 62 | NuclAT_44 | - | - |
| - | 1144133..1144194 | + | 62 | NuclAT_44 | - | - |
| - | 1144133..1144194 | + | 62 | NuclAT_46 | - | - |
| - | 1144133..1144194 | + | 62 | NuclAT_46 | - | - |
| - | 1144133..1144194 | + | 62 | NuclAT_46 | - | - |
| - | 1144133..1144194 | + | 62 | NuclAT_46 | - | - |
| - | 1144133..1144194 | + | 62 | NuclAT_48 | - | - |
| - | 1144133..1144194 | + | 62 | NuclAT_48 | - | - |
| - | 1144133..1144194 | + | 62 | NuclAT_48 | - | - |
| - | 1144133..1144194 | + | 62 | NuclAT_48 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_11 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_11 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_11 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_11 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_13 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_13 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_13 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_13 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_15 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_15 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_15 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_15 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_17 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_17 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_17 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_17 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_19 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_19 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_19 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_19 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_21 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_21 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_21 | - | - |
| - | 1144133..1144195 | + | 63 | NuclAT_21 | - | - |
| AM456_RS06770 | 1144486..1145586 | - | 1101 | WP_032171152.1 | sodium-potassium/proton antiporter ChaA | - |
| AM456_RS06775 | 1145856..1146086 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| AM456_RS06780 | 1146244..1146939 | + | 696 | WP_012311798.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| AM456_RS06785 | 1146983..1147336 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4031.79 Da Isoelectric Point: 11.4779
>T95650 WP_000176713.1 NZ_CP026755:c1143545-1143438 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T95650 NZ_CP026755:c1143545-1143438 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT95650 NZ_CP026755:1143593-1143659 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|