Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-agrB/Ldr(toxin)
Location 1143438..1143659 Replicon chromosome
Accession NZ_CP026755
Organism Escherichia coli strain AR_0077

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag AM456_RS06760 Protein ID WP_000176713.1
Coordinates 1143438..1143545 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name agrB
Locus tag -
Coordinates 1143593..1143659 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AM456_RS06735 1139282..1140364 + 1083 WP_000804726.1 peptide chain release factor 1 -
AM456_RS06740 1140364..1141197 + 834 WP_032171150.1 peptide chain release factor N(5)-glutamine methyltransferase -
AM456_RS06745 1141194..1141586 + 393 WP_000200374.1 invasion regulator SirB2 -
AM456_RS06750 1141590..1142399 + 810 WP_001257044.1 invasion regulator SirB1 -
AM456_RS06755 1142435..1143289 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AM456_RS06760 1143438..1143545 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1143593..1143659 + 67 NuclAT_10 - Antitoxin
- 1143593..1143659 + 67 NuclAT_10 - Antitoxin
- 1143593..1143659 + 67 NuclAT_10 - Antitoxin
- 1143593..1143659 + 67 NuclAT_10 - Antitoxin
- 1143593..1143659 + 67 NuclAT_12 - Antitoxin
- 1143593..1143659 + 67 NuclAT_12 - Antitoxin
- 1143593..1143659 + 67 NuclAT_12 - Antitoxin
- 1143593..1143659 + 67 NuclAT_12 - Antitoxin
- 1143593..1143659 + 67 NuclAT_14 - Antitoxin
- 1143593..1143659 + 67 NuclAT_14 - Antitoxin
- 1143593..1143659 + 67 NuclAT_14 - Antitoxin
- 1143593..1143659 + 67 NuclAT_14 - Antitoxin
- 1143593..1143659 + 67 NuclAT_16 - Antitoxin
- 1143593..1143659 + 67 NuclAT_16 - Antitoxin
- 1143593..1143659 + 67 NuclAT_16 - Antitoxin
- 1143593..1143659 + 67 NuclAT_16 - Antitoxin
- 1143593..1143659 + 67 NuclAT_18 - Antitoxin
- 1143593..1143659 + 67 NuclAT_18 - Antitoxin
- 1143593..1143659 + 67 NuclAT_18 - Antitoxin
- 1143593..1143659 + 67 NuclAT_18 - Antitoxin
- 1143593..1143659 + 67 NuclAT_20 - Antitoxin
- 1143593..1143659 + 67 NuclAT_20 - Antitoxin
- 1143593..1143659 + 67 NuclAT_20 - Antitoxin
- 1143593..1143659 + 67 NuclAT_20 - Antitoxin
- 1143595..1143658 + 64 NuclAT_41 - -
- 1143595..1143658 + 64 NuclAT_41 - -
- 1143595..1143658 + 64 NuclAT_41 - -
- 1143595..1143658 + 64 NuclAT_41 - -
- 1143595..1143658 + 64 NuclAT_43 - -
- 1143595..1143658 + 64 NuclAT_43 - -
- 1143595..1143658 + 64 NuclAT_43 - -
- 1143595..1143658 + 64 NuclAT_43 - -
- 1143595..1143658 + 64 NuclAT_45 - -
- 1143595..1143658 + 64 NuclAT_45 - -
- 1143595..1143658 + 64 NuclAT_45 - -
- 1143595..1143658 + 64 NuclAT_45 - -
- 1143595..1143658 + 64 NuclAT_47 - -
- 1143595..1143658 + 64 NuclAT_47 - -
- 1143595..1143658 + 64 NuclAT_47 - -
- 1143595..1143658 + 64 NuclAT_47 - -
- 1143595..1143658 + 64 NuclAT_49 - -
- 1143595..1143658 + 64 NuclAT_49 - -
- 1143595..1143658 + 64 NuclAT_49 - -
- 1143595..1143658 + 64 NuclAT_49 - -
AM456_RS06765 1143973..1144080 - 108 WP_000170956.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1144133..1144194 + 62 NuclAT_40 - -
- 1144133..1144194 + 62 NuclAT_40 - -
- 1144133..1144194 + 62 NuclAT_40 - -
- 1144133..1144194 + 62 NuclAT_40 - -
- 1144133..1144194 + 62 NuclAT_42 - -
- 1144133..1144194 + 62 NuclAT_42 - -
- 1144133..1144194 + 62 NuclAT_42 - -
- 1144133..1144194 + 62 NuclAT_42 - -
- 1144133..1144194 + 62 NuclAT_44 - -
- 1144133..1144194 + 62 NuclAT_44 - -
- 1144133..1144194 + 62 NuclAT_44 - -
- 1144133..1144194 + 62 NuclAT_44 - -
- 1144133..1144194 + 62 NuclAT_46 - -
- 1144133..1144194 + 62 NuclAT_46 - -
- 1144133..1144194 + 62 NuclAT_46 - -
- 1144133..1144194 + 62 NuclAT_46 - -
- 1144133..1144194 + 62 NuclAT_48 - -
- 1144133..1144194 + 62 NuclAT_48 - -
- 1144133..1144194 + 62 NuclAT_48 - -
- 1144133..1144194 + 62 NuclAT_48 - -
- 1144133..1144195 + 63 NuclAT_11 - -
- 1144133..1144195 + 63 NuclAT_11 - -
- 1144133..1144195 + 63 NuclAT_11 - -
- 1144133..1144195 + 63 NuclAT_11 - -
- 1144133..1144195 + 63 NuclAT_13 - -
- 1144133..1144195 + 63 NuclAT_13 - -
- 1144133..1144195 + 63 NuclAT_13 - -
- 1144133..1144195 + 63 NuclAT_13 - -
- 1144133..1144195 + 63 NuclAT_15 - -
- 1144133..1144195 + 63 NuclAT_15 - -
- 1144133..1144195 + 63 NuclAT_15 - -
- 1144133..1144195 + 63 NuclAT_15 - -
- 1144133..1144195 + 63 NuclAT_17 - -
- 1144133..1144195 + 63 NuclAT_17 - -
- 1144133..1144195 + 63 NuclAT_17 - -
- 1144133..1144195 + 63 NuclAT_17 - -
- 1144133..1144195 + 63 NuclAT_19 - -
- 1144133..1144195 + 63 NuclAT_19 - -
- 1144133..1144195 + 63 NuclAT_19 - -
- 1144133..1144195 + 63 NuclAT_19 - -
- 1144133..1144195 + 63 NuclAT_21 - -
- 1144133..1144195 + 63 NuclAT_21 - -
- 1144133..1144195 + 63 NuclAT_21 - -
- 1144133..1144195 + 63 NuclAT_21 - -
AM456_RS06770 1144486..1145586 - 1101 WP_032171152.1 sodium-potassium/proton antiporter ChaA -
AM456_RS06775 1145856..1146086 + 231 WP_001146444.1 putative cation transport regulator ChaB -
AM456_RS06780 1146244..1146939 + 696 WP_012311798.1 glutathione-specific gamma-glutamylcyclotransferase -
AM456_RS06785 1146983..1147336 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T95650 WP_000176713.1 NZ_CP026755:c1143545-1143438 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T95650 NZ_CP026755:c1143545-1143438 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT95650 NZ_CP026755:1143593-1143659 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8


Antitoxin

Download structure file

References