Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 45103..45334 | Replicon | plasmid p266917_2_01 |
| Accession | NZ_CP026724 | ||
| Organism | Escherichia coli strain 266917_2 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | C4R22_RS28975 | Protein ID | WP_023144756.1 |
| Coordinates | 45103..45237 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 45283..45334 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C4R22_RS28925 | 40442..40924 | - | 483 | WP_001402899.1 | hypothetical protein | - |
| C4R22_RS28930 | 41041..41880 | - | 840 | WP_001402900.1 | 3'-5' exonuclease | - |
| C4R22_RS28935 | 41926..42207 | - | 282 | WP_001402901.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| C4R22_RS28940 | 42204..42473 | - | 270 | WP_000079941.1 | hypothetical protein | - |
| C4R22_RS28955 | 43390..44247 | - | 858 | WP_000130641.1 | incFII family plasmid replication initiator RepA | - |
| C4R22_RS28960 | 44240..44314 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| C4R22_RS31930 | 44311..44445 | - | 135 | Protein_51 | protein CopA/IncA | - |
| C4R22_RS28970 | 44552..44806 | - | 255 | WP_089643063.1 | replication regulatory protein RepA | - |
| C4R22_RS28975 | 45103..45237 | - | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 45283..45334 | + | 52 | NuclAT_1 | - | Antitoxin |
| - | 45283..45334 | + | 52 | NuclAT_1 | - | Antitoxin |
| - | 45283..45334 | + | 52 | NuclAT_1 | - | Antitoxin |
| - | 45283..45334 | + | 52 | NuclAT_1 | - | Antitoxin |
| C4R22_RS28980 | 45301..45587 | - | 287 | Protein_54 | DUF2726 domain-containing protein | - |
| C4R22_RS28990 | 46099..46311 | - | 213 | WP_104858475.1 | ANR family transcriptional regulator | - |
| C4R22_RS28995 | 46443..47003 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| C4R22_RS29000 | 47058..47804 | - | 747 | WP_032188604.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | pic / aap/aspU / aggA / aggB / aggC / aggD | 1..129627 | 129627 | |
| - | flank | IS/Tn | - | - | 39260..40282 | 1022 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T95588 WP_023144756.1 NZ_CP026724:c45237-45103 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T95588 NZ_CP026724:c45237-45103 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
Antitoxin
Download Length: 52 bp
>AT95588 NZ_CP026724:45283-45334 [Escherichia coli]
TCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|