Detailed information of TA system TA095367

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 97201..97470
• Replicon: plasmid pFORC82_2
• Accession: NZ_CP026643
• Organism: Escherichia coli strain FORC_082

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: FORC82_RS25415
• Protein ID: WP_001372321.1
• Coordinates: 97345..97470 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	97201..97266 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
FORC82_RS25375	92420..93391	+	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-
FORC82_RS26840	94028..94197	+	170	Protein_97	hypothetical protein	-
FORC82_RS26845	94380..94460	-	81	Protein_98	hypothetical protein	-
FORC82_RS26285	94530..94736	+	207	WP_000275856.1	hypothetical protein	-
FORC82_RS25390	94762..95301	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
FORC82_RS25395	95369..95602	+	234	WP_000005990.1	DUF905 family protein	-
FORC82_RS25400	95630..95827	+	198	Protein_102	hypothetical protein	-
FORC82_RS25405	95882..96316	+	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
FORC82_RS25410	96313..97075	+	763	Protein_104	plasmid SOS inhibition protein A	-
FORC82_RS26155	97044..97232	-	189	WP_001299721.1	hypothetical protein	-
-	97044..97268	+	225	NuclAT_0	-	-
-	97044..97268	+	225	NuclAT_0	-	-
-	97044..97268	+	225	NuclAT_0	-	-
-	97044..97268	+	225	NuclAT_0	-	-
-	97201..97266	+	66	-	-	Antitoxin
FORC82_RS26850	97254..97403	+	150	Protein_106	plasmid maintenance protein Mok	-
FORC82_RS25415	97345..97470	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
FORC82_RS26160	97689..97919	+	231	WP_071586998.1	hypothetical protein	-
FORC82_RS26855	97917..98089	-	173	Protein_109	hypothetical protein	-
FORC82_RS26860	98159..98365	+	207	WP_000547968.1	hypothetical protein	-
FORC82_RS25425	98390..98677	+	288	WP_000107535.1	hypothetical protein	-
FORC82_RS25430	98794..99615	+	822	WP_001234426.1	DUF932 domain-containing protein	-
FORC82_RS25435	99912..100502	-	591	WP_001376243.1	transglycosylase SLT domain-containing protein	-
FORC82_RS25440	100835..101218	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	sitABCD	vat / iroN / iroN / iroE / iroD / iroD / iroC / iroB / iucA / iucB / iucB / iucC / iucD / iutA	1..101404	101404

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T95367 WP_001372321.1 NZ_CP026643:97345-97470 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T95367 NZ_CP026643:97345-97470 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT95367 NZ_CP026643:97201-97266 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin