Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 9503..9757 | Replicon | plasmid pFORC82_2 |
| Accession | NZ_CP026643 | ||
| Organism | Escherichia coli strain FORC_082 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | FORC82_RS24895 | Protein ID | WP_001312851.1 |
| Coordinates | 9608..9757 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 9503..9564 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FORC82_RS24855 (4588) | 4588..5220 | + | 633 | WP_001203720.1 | type-F conjugative transfer system protein TraW | - |
| FORC82_RS24860 (5217) | 5217..5381 | + | 165 | Protein_10 | TraU family protein | - |
| FORC82_RS24865 (5401) | 5401..6935 | + | 1535 | Protein_11 | type-F conjugative transfer system mating-pair stabilization protein TraN | - |
| FORC82_RS24875 (7058) | 7058..7918 | + | 861 | WP_096969648.1 | alpha/beta hydrolase | - |
| FORC82_RS24880 (8021) | 8021..8581 | + | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| FORC82_RS24885 (8717) | 8717..8929 | + | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| FORC82_RS26265 (9174) | 9174..9248 | + | 75 | Protein_15 | endonuclease | - |
| - (9503) | 9503..9564 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (9503) | 9503..9564 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (9503) | 9503..9564 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (9503) | 9503..9564 | - | 62 | NuclAT_1 | - | Antitoxin |
| FORC82_RS24895 (9608) | 9608..9757 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| FORC82_RS24900 (10041) | 10041..10298 | + | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| FORC82_RS26785 (10315) | 10315..10566 | - | 252 | WP_223195197.1 | replication protein RepA | - |
| FORC82_RS26790 (10557) | 10557..10604 | + | 48 | WP_229471593.1 | hypothetical protein | - |
| FORC82_RS24915 (10597) | 10597..11079 | + | 483 | WP_001273588.1 | hypothetical protein | - |
| FORC82_RS24920 (11072) | 11072..11929 | + | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| FORC82_RS24935 (12856) | 12856..13200 | + | 345 | WP_001553768.1 | hypothetical protein | - |
| FORC82_RS24945 (13381) | 13381..14496 | - | 1116 | Protein_23 | IS91 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | sitABCD | vat / iroN / iroN / iroE / iroD / iroD / iroC / iroB / iucA / iucB / iucB / iucC / iucD / iutA | 1..101404 | 101404 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T95363 WP_001312851.1 NZ_CP026643:9608-9757 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T95363 NZ_CP026643:9608-9757 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGAGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGAGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 62 bp
>AT95363 NZ_CP026643:c9564-9503 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
