Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 37690..37959 | Replicon | plasmid p3 |
Accession | NZ_CP026589 | ||
Organism | Klebsiella pneumoniae strain NUHL30457 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | C3483_RS30855 | Protein ID | WP_001312861.1 |
Coordinates | 37801..37959 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 37690..37755 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C3483_RS28895 | 33400..33927 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
C3483_RS28900 | 33985..34218 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
C3483_RS28905 | 34279..36302 | + | 2024 | Protein_46 | ParB/RepB/Spo0J family partition protein | - |
C3483_RS28910 | 36371..36805 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
C3483_RS28915 | 36802..37521 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 37533..37757 | + | 225 | NuclAT_0 | - | - |
- | 37533..37757 | + | 225 | NuclAT_0 | - | - |
- | 37533..37757 | + | 225 | NuclAT_0 | - | - |
- | 37533..37757 | + | 225 | NuclAT_0 | - | - |
- | 37690..37755 | + | 66 | - | - | Antitoxin |
C3483_RS30855 | 37801..37959 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
C3483_RS31005 | 38197..38574 | - | 378 | Protein_50 | hypothetical protein | - |
C3483_RS28940 | 38874..39170 | + | 297 | WP_001272251.1 | hypothetical protein | - |
C3483_RS28945 | 39281..40102 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
C3483_RS28950 | 40399..41046 | - | 648 | WP_104716617.1 | transglycosylase SLT domain-containing protein | - |
C3483_RS28955 | 41323..41706 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
C3483_RS28960 | 41897..42583 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
C3483_RS28965 | 42677..42904 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2 | - | 1..89247 | 89247 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T95203 WP_001312861.1 NZ_CP026589:37801-37959 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T95203 NZ_CP026589:37801-37959 [Klebsiella pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT95203 NZ_CP026589:37690-37755 [Klebsiella pneumoniae]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|