Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 155003..155256 | Replicon | plasmid pKPC2_095649 |
Accession | NZ_CP026584 | ||
Organism | Klebsiella pneumoniae strain WCHKP649 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | BT120_RS01265 | Protein ID | WP_001312851.1 |
Coordinates | 155107..155256 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 155003..155062 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BT120_RS01220 | 150663..150728 | - | 66 | Protein_219 | hypothetical protein | - |
BT120_RS01225 | 150781..151485 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
BT120_RS01230 | 151549..151710 | + | 162 | Protein_221 | DNA helicase | - |
BT120_RS01235 | 151730..152476 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
BT120_RS01240 | 152531..153091 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
BT120_RS01245 | 153223..153423 | + | 201 | WP_015059022.1 | hypothetical protein | - |
BT120_RS01250 | 153809..154408 | + | 600 | WP_032083981.1 | hypothetical protein | - |
BT120_RS01255 | 154572..154802 | + | 231 | WP_001736714.1 | hypothetical protein | - |
BT120_RS01260 | 154825..155052 | - | 228 | Protein_227 | hypothetical protein | - |
- | 155003..155062 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 155003..155062 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 155003..155062 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 155003..155062 | - | 60 | NuclAT_1 | - | Antitoxin |
BT120_RS01265 | 155107..155256 | + | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
BT120_RS01270 | 155540..155788 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
BT120_RS01275 | 155789..155998 | - | 210 | WP_064765370.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB / catA2 | - | 1..156099 | 156099 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T95159 WP_001312851.1 NZ_CP026584:155107-155256 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T95159 NZ_CP026584:155107-155256 [Klebsiella pneumoniae]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT95159 NZ_CP026584:c155062-155003 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|