Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 66615..67041 | Replicon | plasmid pRmtB1_005237 |
Accession | NZ_CP026579 | ||
Organism | Escherichia coli strain WCHEC005237 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | C4E05_RS01945 | Protein ID | WP_034169443.1 |
Coordinates | 66615..66773 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 66817..67041 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C4E05_RS01900 | 61665..61892 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
C4E05_RS01905 | 61986..62672 | - | 687 | WP_001825184.1 | PAS domain-containing protein | - |
C4E05_RS01910 | 62863..63246 | - | 384 | WP_000124981.1 | relaxosome protein TraM | - |
C4E05_RS01915 | 63523..64170 | + | 648 | WP_000614935.1 | transglycosylase SLT domain-containing protein | - |
C4E05_RS01920 | 64467..65288 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
C4E05_RS01925 | 65406..65693 | - | 288 | WP_000107535.1 | hypothetical protein | - |
C4E05_RS01930 | 65718..65924 | - | 207 | WP_000547971.1 | hypothetical protein | - |
C4E05_RS01945 | 66615..66773 | - | 159 | WP_034169443.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 66817..67041 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 66817..67041 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 66817..67041 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 66817..67041 | - | 225 | NuclAT_0 | - | Antitoxin |
C4E05_RS25715 | 66853..67041 | + | 189 | WP_001299721.1 | hypothetical protein | - |
C4E05_RS01950 | 67053..67772 | - | 720 | WP_050858785.1 | plasmid SOS inhibition protein A | - |
C4E05_RS01955 | 67769..68203 | - | 435 | WP_032217500.1 | conjugation system SOS inhibitor PsiB | - |
C4E05_RS01960 | 68258..70216 | - | 1959 | WP_072652246.1 | ParB/RepB/Spo0J family partition protein | - |
C4E05_RS01965 | 70281..70514 | - | 234 | WP_000006030.1 | DUF905 family protein | - |
C4E05_RS01970 | 70576..71115 | - | 540 | WP_009426937.1 | single-stranded DNA-binding protein | - |
C4E05_RS01975 | 71141..71347 | - | 207 | WP_000547971.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / rmtB / sul1 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr / tet(A) | - | 1..100229 | 100229 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T95122 WP_034169443.1 NZ_CP026579:c66773-66615 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCELRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCELRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T95122 NZ_CP026579:c66773-66615 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGCTTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGCTTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 225 bp
>AT95122 NZ_CP026579:c67041-66817 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|