Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 30050..30320 | Replicon | plasmid pCTX-M-55_005237 |
Accession | NZ_CP026576 | ||
Organism | Escherichia coli strain WCHEC005237 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | C4E05_RS00370 | Protein ID | WP_001312861.1 |
Coordinates | 30162..30320 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 30050..30113 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C4E05_RS00345 | 25761..26288 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
C4E05_RS00350 | 26346..26579 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
C4E05_RS00355 | 26640..28663 | + | 2024 | Protein_37 | ParB/RepB/Spo0J family partition protein | - |
C4E05_RS00360 | 28732..29166 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
C4E05_RS00365 | 29163..29882 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 29894..30118 | + | 225 | NuclAT_0 | - | - |
- | 29894..30118 | + | 225 | NuclAT_0 | - | - |
- | 29894..30118 | + | 225 | NuclAT_0 | - | - |
- | 29894..30118 | + | 225 | NuclAT_0 | - | - |
C4E05_RS25665 | 29903..30082 | - | 180 | WP_001309233.1 | hypothetical protein | - |
- | 30050..30113 | - | 64 | - | - | Antitoxin |
C4E05_RS00370 | 30162..30320 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
C4E05_RS25670 | 30558..30935 | - | 378 | Protein_42 | hypothetical protein | - |
C4E05_RS00390 | 31235..31531 | + | 297 | WP_001272251.1 | hypothetical protein | - |
C4E05_RS00395 | 31642..32463 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
C4E05_RS00400 | 32760..33407 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
C4E05_RS00405 | 33684..34067 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
C4E05_RS00410 | 34258..34944 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
C4E05_RS00415 | 35038..35265 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | fosA3 / blaTEM-1B / blaCTX-M-55 | - | 1..70688 | 70688 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T95115 WP_001312861.1 NZ_CP026576:30162-30320 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T95115 NZ_CP026576:30162-30320 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT95115 NZ_CP026576:c30113-30050 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|