Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 5062321..5062542 Replicon chromosome
Accession NZ_CP026491
Organism Escherichia coli strain HS13-1

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag C3K24_RS26265 Protein ID WP_000170954.1
Coordinates 5062321..5062428 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 5062481..5062542 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C3K24_RS26240 5058166..5059248 + 1083 WP_000804726.1 peptide chain release factor 1 -
C3K24_RS26245 5059248..5060081 + 834 WP_000456474.1 peptide chain release factor N(5)-glutamine methyltransferase -
C3K24_RS26250 5060078..5060470 + 393 WP_000200375.1 invasion regulator SirB2 -
C3K24_RS26255 5060474..5061283 + 810 WP_001257054.1 invasion regulator SirB1 -
C3K24_RS26260 5061319..5062173 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
C3K24_RS26265 5062321..5062428 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 5062481..5062542 + 62 NuclAT_12 - Antitoxin
- 5062481..5062542 + 62 NuclAT_12 - Antitoxin
- 5062481..5062542 + 62 NuclAT_12 - Antitoxin
- 5062481..5062542 + 62 NuclAT_12 - Antitoxin
- 5062481..5062542 + 62 NuclAT_13 - Antitoxin
- 5062481..5062542 + 62 NuclAT_13 - Antitoxin
- 5062481..5062542 + 62 NuclAT_13 - Antitoxin
- 5062481..5062542 + 62 NuclAT_13 - Antitoxin
- 5062481..5062542 + 62 NuclAT_14 - Antitoxin
- 5062481..5062542 + 62 NuclAT_14 - Antitoxin
- 5062481..5062542 + 62 NuclAT_14 - Antitoxin
- 5062481..5062542 + 62 NuclAT_14 - Antitoxin
- 5062481..5062542 + 62 NuclAT_15 - Antitoxin
- 5062481..5062542 + 62 NuclAT_15 - Antitoxin
- 5062481..5062542 + 62 NuclAT_15 - Antitoxin
- 5062481..5062542 + 62 NuclAT_15 - Antitoxin
- 5062481..5062542 + 62 NuclAT_16 - Antitoxin
- 5062481..5062542 + 62 NuclAT_16 - Antitoxin
- 5062481..5062542 + 62 NuclAT_16 - Antitoxin
- 5062481..5062542 + 62 NuclAT_16 - Antitoxin
- 5062481..5062542 + 62 NuclAT_17 - Antitoxin
- 5062481..5062542 + 62 NuclAT_17 - Antitoxin
- 5062481..5062542 + 62 NuclAT_17 - Antitoxin
- 5062481..5062542 + 62 NuclAT_17 - Antitoxin
- 5062481..5062543 + 63 NuclAT_10 - -
- 5062481..5062543 + 63 NuclAT_10 - -
- 5062481..5062543 + 63 NuclAT_10 - -
- 5062481..5062543 + 63 NuclAT_10 - -
- 5062481..5062543 + 63 NuclAT_11 - -
- 5062481..5062543 + 63 NuclAT_11 - -
- 5062481..5062543 + 63 NuclAT_11 - -
- 5062481..5062543 + 63 NuclAT_11 - -
- 5062481..5062543 + 63 NuclAT_6 - -
- 5062481..5062543 + 63 NuclAT_6 - -
- 5062481..5062543 + 63 NuclAT_6 - -
- 5062481..5062543 + 63 NuclAT_6 - -
- 5062481..5062543 + 63 NuclAT_7 - -
- 5062481..5062543 + 63 NuclAT_7 - -
- 5062481..5062543 + 63 NuclAT_7 - -
- 5062481..5062543 + 63 NuclAT_7 - -
- 5062481..5062543 + 63 NuclAT_8 - -
- 5062481..5062543 + 63 NuclAT_8 - -
- 5062481..5062543 + 63 NuclAT_8 - -
- 5062481..5062543 + 63 NuclAT_8 - -
- 5062481..5062543 + 63 NuclAT_9 - -
- 5062481..5062543 + 63 NuclAT_9 - -
- 5062481..5062543 + 63 NuclAT_9 - -
- 5062481..5062543 + 63 NuclAT_9 - -
- 5062481..5062544 + 64 NuclAT_18 - -
- 5062481..5062544 + 64 NuclAT_18 - -
- 5062481..5062544 + 64 NuclAT_18 - -
- 5062481..5062544 + 64 NuclAT_18 - -
- 5062481..5062544 + 64 NuclAT_19 - -
- 5062481..5062544 + 64 NuclAT_19 - -
- 5062481..5062544 + 64 NuclAT_19 - -
- 5062481..5062544 + 64 NuclAT_19 - -
- 5062481..5062544 + 64 NuclAT_20 - -
- 5062481..5062544 + 64 NuclAT_20 - -
- 5062481..5062544 + 64 NuclAT_20 - -
- 5062481..5062544 + 64 NuclAT_20 - -
- 5062481..5062544 + 64 NuclAT_21 - -
- 5062481..5062544 + 64 NuclAT_21 - -
- 5062481..5062544 + 64 NuclAT_21 - -
- 5062481..5062544 + 64 NuclAT_21 - -
- 5062481..5062544 + 64 NuclAT_22 - -
- 5062481..5062544 + 64 NuclAT_22 - -
- 5062481..5062544 + 64 NuclAT_22 - -
- 5062481..5062544 + 64 NuclAT_22 - -
- 5062481..5062544 + 64 NuclAT_23 - -
- 5062481..5062544 + 64 NuclAT_23 - -
- 5062481..5062544 + 64 NuclAT_23 - -
- 5062481..5062544 + 64 NuclAT_23 - -
C3K24_RS26270 5062834..5063934 - 1101 WP_001313768.1 sodium-potassium/proton antiporter ChaA -
C3K24_RS26275 5064204..5064434 + 231 WP_001146444.1 putative cation transport regulator ChaB -
C3K24_RS26280 5064592..5065287 + 696 WP_000632706.1 glutathione-specific gamma-glutamylcyclotransferase -
C3K24_RS26285 5065331..5065684 - 354 WP_001169658.1 DsrE/F sulfur relay family protein YchN -
C3K24_RS26290 5065869..5067263 + 1395 WP_000086194.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T94997 WP_000170954.1 NZ_CP026491:c5062428-5062321 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T94997 NZ_CP026491:c5062428-5062321 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT94997 NZ_CP026491:5062481-5062542 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References