Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 103808..104047 | Replicon | plasmid pKBN10P04869A |
Accession | NZ_CP026474 | ||
Organism | Escherichia coli strain KBN10P04869 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | A0A762TWR7 |
Locus tag | YKEC1_RS25550 | Protein ID | WP_023144756.1 |
Coordinates | 103913..104047 (+) | Length | 45 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 103808..103868 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
YKEC1_RS25520 | 98925..101318 | + | 2394 | Protein_113 | AAA family ATPase | - |
YKEC1_RS25525 | 101338..102084 | + | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
YKEC1_RS25530 | 102139..102699 | + | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
YKEC1_RS25535 | 102830..103042 | + | 213 | WP_013023861.1 | hypothetical protein | - |
YKEC1_RS26905 | 103555..103841 | + | 287 | Protein_117 | DUF2726 domain-containing protein | - |
- | 103808..103868 | - | 61 | NuclAT_0 | - | Antitoxin |
- | 103808..103868 | - | 61 | NuclAT_0 | - | Antitoxin |
- | 103808..103868 | - | 61 | NuclAT_0 | - | Antitoxin |
- | 103808..103868 | - | 61 | NuclAT_0 | - | Antitoxin |
YKEC1_RS25550 | 103913..104047 | + | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
YKEC1_RS25555 | 104344..104598 | + | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
YKEC1_RS25560 | 104758..105504 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
YKEC1_RS25565 | 105519..107060 | - | 1542 | WP_002431311.1 | IS21-like element ISEc12 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id / mph(A) / aac(3)-IId / aadA5 / qacE / sul1 / blaNDM-5 / dfrA12 / aadA2 / tet(B) | - | 1..107229 | 107229 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T94967 WP_023144756.1 NZ_CP026474:103913-104047 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T94967 NZ_CP026474:103913-104047 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
Antitoxin
Download Length: 61 bp
>AT94967 NZ_CP026474:c103868-103808 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|