Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 37820..38090 | Replicon | plasmid pECO-816c |
Accession | NZ_CP026403 | ||
Organism | Escherichia coli strain ECONIH4 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | C3F40_RS28800 | Protein ID | WP_001312861.1 |
Coordinates | 37932..38090 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 37820..37883 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C3F40_RS31625 | 33356..33562 | + | 207 | WP_000275853.1 | hypothetical protein | - |
C3F40_RS28775 | 33588..34127 | + | 540 | WP_000290838.1 | single-stranded DNA-binding protein | - |
C3F40_RS28780 | 34190..34423 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
C3F40_RS28785 | 34489..36447 | + | 1959 | WP_097734687.1 | ParB/RepB/Spo0J family partition protein | - |
C3F40_RS28790 | 36502..36936 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
C3F40_RS28795 | 36933..37652 | + | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
C3F40_RS31385 | 37664..37852 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 37664..37888 | + | 225 | NuclAT_0 | - | - |
- | 37664..37888 | + | 225 | NuclAT_0 | - | - |
- | 37664..37888 | + | 225 | NuclAT_0 | - | - |
- | 37664..37888 | + | 225 | NuclAT_0 | - | - |
- | 37820..37883 | - | 64 | - | - | Antitoxin |
C3F40_RS28800 | 37932..38090 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
C3F40_RS28820 | 39012..39299 | + | 288 | WP_000107548.1 | hypothetical protein | - |
C3F40_RS28825 | 39419..40240 | + | 822 | WP_139942663.1 | DUF945 domain-containing protein | - |
C3F40_RS28830 | 40537..41139 | - | 603 | WP_077815103.1 | transglycosylase SLT domain-containing protein | - |
C3F40_RS28835 | 41460..41843 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
C3F40_RS28840 | 42030..42719 | + | 690 | WP_097734686.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..103161 | 103161 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T94827 WP_001312861.1 NZ_CP026403:37932-38090 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T94827 NZ_CP026403:37932-38090 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT94827 NZ_CP026403:c37883-37820 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|