Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1270238..1270460 Replicon chromosome
Accession NZ_CP026360
Organism Escherichia coli strain 1FA

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag C2R01_RS06680 Protein ID WP_000170955.1
Coordinates 1270238..1270345 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1270393..1270460 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C2R01_RS06645 1266094..1266927 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
C2R01_RS06650 1266924..1267316 + 393 WP_000200374.1 invasion regulator SirB2 -
C2R01_RS06655 1267320..1268129 + 810 WP_001257044.1 invasion regulator SirB1 -
C2R01_RS06660 1268165..1269019 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
C2R01_RS06665 1269168..1269275 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1269323..1269389 + 67 NuclAT_34 - -
- 1269323..1269389 + 67 NuclAT_34 - -
- 1269323..1269389 + 67 NuclAT_34 - -
- 1269323..1269389 + 67 NuclAT_34 - -
- 1269323..1269389 + 67 NuclAT_36 - -
- 1269323..1269389 + 67 NuclAT_36 - -
- 1269323..1269389 + 67 NuclAT_36 - -
- 1269323..1269389 + 67 NuclAT_36 - -
- 1269323..1269389 + 67 NuclAT_38 - -
- 1269323..1269389 + 67 NuclAT_38 - -
- 1269323..1269389 + 67 NuclAT_38 - -
- 1269323..1269389 + 67 NuclAT_38 - -
- 1269323..1269389 + 67 NuclAT_40 - -
- 1269323..1269389 + 67 NuclAT_40 - -
- 1269323..1269389 + 67 NuclAT_40 - -
- 1269323..1269389 + 67 NuclAT_40 - -
- 1269323..1269389 + 67 NuclAT_42 - -
- 1269323..1269389 + 67 NuclAT_42 - -
- 1269323..1269389 + 67 NuclAT_42 - -
- 1269323..1269389 + 67 NuclAT_42 - -
- 1269323..1269389 + 67 NuclAT_44 - -
- 1269323..1269389 + 67 NuclAT_44 - -
- 1269323..1269389 + 67 NuclAT_44 - -
- 1269323..1269389 + 67 NuclAT_44 - -
- 1269325..1269390 + 66 NuclAT_18 - -
- 1269325..1269390 + 66 NuclAT_18 - -
- 1269325..1269390 + 66 NuclAT_18 - -
- 1269325..1269390 + 66 NuclAT_18 - -
- 1269325..1269390 + 66 NuclAT_21 - -
- 1269325..1269390 + 66 NuclAT_21 - -
- 1269325..1269390 + 66 NuclAT_21 - -
- 1269325..1269390 + 66 NuclAT_21 - -
- 1269325..1269390 + 66 NuclAT_24 - -
- 1269325..1269390 + 66 NuclAT_24 - -
- 1269325..1269390 + 66 NuclAT_24 - -
- 1269325..1269390 + 66 NuclAT_24 - -
- 1269325..1269390 + 66 NuclAT_27 - -
- 1269325..1269390 + 66 NuclAT_27 - -
- 1269325..1269390 + 66 NuclAT_27 - -
- 1269325..1269390 + 66 NuclAT_27 - -
- 1269325..1269390 + 66 NuclAT_30 - -
- 1269325..1269390 + 66 NuclAT_30 - -
- 1269325..1269390 + 66 NuclAT_30 - -
- 1269325..1269390 + 66 NuclAT_30 - -
- 1269325..1269390 + 66 NuclAT_33 - -
- 1269325..1269390 + 66 NuclAT_33 - -
- 1269325..1269390 + 66 NuclAT_33 - -
- 1269325..1269390 + 66 NuclAT_33 - -
C2R01_RS06670 1269703..1269810 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 1269858..1269925 + 68 NuclAT_17 - -
- 1269858..1269925 + 68 NuclAT_17 - -
- 1269858..1269925 + 68 NuclAT_17 - -
- 1269858..1269925 + 68 NuclAT_17 - -
- 1269858..1269925 + 68 NuclAT_20 - -
- 1269858..1269925 + 68 NuclAT_20 - -
- 1269858..1269925 + 68 NuclAT_20 - -
- 1269858..1269925 + 68 NuclAT_20 - -
- 1269858..1269925 + 68 NuclAT_23 - -
- 1269858..1269925 + 68 NuclAT_23 - -
- 1269858..1269925 + 68 NuclAT_23 - -
- 1269858..1269925 + 68 NuclAT_23 - -
- 1269858..1269925 + 68 NuclAT_26 - -
- 1269858..1269925 + 68 NuclAT_26 - -
- 1269858..1269925 + 68 NuclAT_26 - -
- 1269858..1269925 + 68 NuclAT_26 - -
- 1269858..1269925 + 68 NuclAT_29 - -
- 1269858..1269925 + 68 NuclAT_29 - -
- 1269858..1269925 + 68 NuclAT_29 - -
- 1269858..1269925 + 68 NuclAT_29 - -
- 1269858..1269925 + 68 NuclAT_32 - -
- 1269858..1269925 + 68 NuclAT_32 - -
- 1269858..1269925 + 68 NuclAT_32 - -
- 1269858..1269925 + 68 NuclAT_32 - -
- 1269859..1269924 + 66 NuclAT_35 - -
- 1269859..1269924 + 66 NuclAT_35 - -
- 1269859..1269924 + 66 NuclAT_35 - -
- 1269859..1269924 + 66 NuclAT_35 - -
- 1269859..1269924 + 66 NuclAT_37 - -
- 1269859..1269924 + 66 NuclAT_37 - -
- 1269859..1269924 + 66 NuclAT_37 - -
- 1269859..1269924 + 66 NuclAT_37 - -
- 1269859..1269924 + 66 NuclAT_39 - -
- 1269859..1269924 + 66 NuclAT_39 - -
- 1269859..1269924 + 66 NuclAT_39 - -
- 1269859..1269924 + 66 NuclAT_39 - -
- 1269859..1269924 + 66 NuclAT_41 - -
- 1269859..1269924 + 66 NuclAT_41 - -
- 1269859..1269924 + 66 NuclAT_41 - -
- 1269859..1269924 + 66 NuclAT_41 - -
- 1269859..1269924 + 66 NuclAT_43 - -
- 1269859..1269924 + 66 NuclAT_43 - -
- 1269859..1269924 + 66 NuclAT_43 - -
- 1269859..1269924 + 66 NuclAT_43 - -
- 1269859..1269924 + 66 NuclAT_45 - -
- 1269859..1269924 + 66 NuclAT_45 - -
- 1269859..1269924 + 66 NuclAT_45 - -
- 1269859..1269924 + 66 NuclAT_45 - -
C2R01_RS06680 1270238..1270345 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC Toxin
- 1270393..1270460 + 68 NuclAT_16 - Antitoxin
- 1270393..1270460 + 68 NuclAT_16 - Antitoxin
- 1270393..1270460 + 68 NuclAT_16 - Antitoxin
- 1270393..1270460 + 68 NuclAT_16 - Antitoxin
- 1270393..1270460 + 68 NuclAT_19 - Antitoxin
- 1270393..1270460 + 68 NuclAT_19 - Antitoxin
- 1270393..1270460 + 68 NuclAT_19 - Antitoxin
- 1270393..1270460 + 68 NuclAT_19 - Antitoxin
- 1270393..1270460 + 68 NuclAT_22 - Antitoxin
- 1270393..1270460 + 68 NuclAT_22 - Antitoxin
- 1270393..1270460 + 68 NuclAT_22 - Antitoxin
- 1270393..1270460 + 68 NuclAT_22 - Antitoxin
- 1270393..1270460 + 68 NuclAT_25 - Antitoxin
- 1270393..1270460 + 68 NuclAT_25 - Antitoxin
- 1270393..1270460 + 68 NuclAT_25 - Antitoxin
- 1270393..1270460 + 68 NuclAT_25 - Antitoxin
- 1270393..1270460 + 68 NuclAT_28 - Antitoxin
- 1270393..1270460 + 68 NuclAT_28 - Antitoxin
- 1270393..1270460 + 68 NuclAT_28 - Antitoxin
- 1270393..1270460 + 68 NuclAT_28 - Antitoxin
- 1270393..1270460 + 68 NuclAT_31 - Antitoxin
- 1270393..1270460 + 68 NuclAT_31 - Antitoxin
- 1270393..1270460 + 68 NuclAT_31 - Antitoxin
- 1270393..1270460 + 68 NuclAT_31 - Antitoxin
C2R01_RS06685 1270749..1271849 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
C2R01_RS06690 1272119..1272349 + 231 WP_001146444.1 putative cation transport regulator ChaB -
C2R01_RS06695 1272507..1273202 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
C2R01_RS06700 1273246..1273599 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
C2R01_RS06705 1273784..1275178 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T94626 WP_000170955.1 NZ_CP026360:c1270345-1270238 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T94626 NZ_CP026360:c1270345-1270238 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT94626 NZ_CP026360:1270393-1270460 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A829J2A9


Antitoxin

Download structure file

References