Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 3699980..3700202 | Replicon | chromosome |
Accession | NZ_CP026348 | ||
Organism | Escherichia coli strain 6FA |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1E8T8 |
Locus tag | C2R15_RS19225 | Protein ID | WP_000141634.1 |
Coordinates | 3699980..3700087 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 3700136..3700202 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C2R15_RS19200 | 3695233..3695985 | - | 753 | Protein_3513 | cellulose biosynthesis protein BcsQ | - |
C2R15_RS19205 | 3695997..3696185 | - | 189 | WP_001063318.1 | YhjR family protein | - |
C2R15_RS19210 | 3696458..3698029 | + | 1572 | WP_001204931.1 | cellulose biosynthesis protein BcsE | - |
C2R15_RS19215 | 3698026..3698217 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
C2R15_RS19220 | 3698214..3699893 | + | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
C2R15_RS19225 | 3699980..3700087 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
- | 3700136..3700202 | + | 67 | - | - | Antitoxin |
C2R15_RS19240 | 3700563..3701834 | + | 1272 | WP_001295225.1 | transporter | - |
C2R15_RS19245 | 3701864..3702868 | - | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
C2R15_RS19250 | 3702865..3703848 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
C2R15_RS19255 | 3703859..3704761 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T94137 WP_000141634.1 NZ_CP026348:c3700087-3699980 [Escherichia coli]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T94137 NZ_CP026348:c3700087-3699980 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT94137 NZ_CP026348:3700136-3700202 [Escherichia coli]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|