Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 81555..81825 | Replicon | plasmid pNDM-d2e9 |
| Accession | NZ_CP026201 | ||
| Organism | Escherichia coli strain ECONIH6 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | C2U45_RS26135 | Protein ID | WP_001312861.1 |
| Coordinates | 81667..81825 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 81555..81618 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C2U45_RS26110 | 77365..77862 | + | 498 | WP_095719660.1 | single-stranded DNA-binding protein | - |
| C2U45_RS26115 | 77925..78158 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| C2U45_RS26120 | 78224..80182 | + | 1959 | WP_001825193.1 | ParB/RepB/Spo0J family partition protein | - |
| C2U45_RS26125 | 80237..80671 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| C2U45_RS26130 | 80668..81387 | + | 720 | WP_013362833.1 | plasmid SOS inhibition protein A | - |
| C2U45_RS26565 | 81399..81587 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 81399..81623 | + | 225 | NuclAT_0 | - | - |
| - | 81399..81623 | + | 225 | NuclAT_0 | - | - |
| - | 81399..81623 | + | 225 | NuclAT_0 | - | - |
| - | 81399..81623 | + | 225 | NuclAT_0 | - | - |
| - | 81555..81618 | - | 64 | - | - | Antitoxin |
| C2U45_RS26135 | 81667..81825 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| C2U45_RS26140 | 82220..83887 | - | 1668 | WP_012372796.1 | group II intron reverse transcriptase/maturase | - |
| C2U45_RS26155 | 85090..85377 | + | 288 | WP_000107544.1 | hypothetical protein | - |
| C2U45_RS26160 | 85495..86316 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | erm(B) / mph(A) / blaTEM-1B / rmtB / blaNDM-5 / sul1 / qacE / aadA2 / dfrA12 | - | 1..100989 | 100989 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T93683 WP_001312861.1 NZ_CP026201:81667-81825 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T93683 NZ_CP026201:81667-81825 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT93683 NZ_CP026201:c81618-81555 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|