Detailed information of TA system TA093456

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 55442..55695
• Replicon: plasmid pF127_1
• Accession: NZ_CP026141
• Organism: Klebsiella pneumoniae strain F127

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: G9G1E3
• Locus tag: C2L73_RS28250
• Protein ID: WP_001312851.1
• Coordinates: 55442..55591 (-)
• Length: 50 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	55636..55695 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
C2L73_RS28205	50801..51216	-	416	Protein_69	IS1 family transposase	-
C2L73_RS28210	51465..51866	-	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
C2L73_RS28215	51799..52056	-	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
C2L73_RS28220	52149..52802	-	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
C2L73_RS28230	53741..54598	-	858	WP_032495102.1	incFII family plasmid replication initiator RepA	-
C2L73_RS28235	54591..54665	-	75	WP_001375168.1	RepA leader peptide Tap	-
C2L73_RS28245	54910..55158	-	249	WP_000083837.1	replication regulatory protein RepA	-
C2L73_RS28250	55442..55591	-	150	WP_001312851.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	55636..55695	+	60	NuclAT_1	-	Antitoxin
-	55636..55695	+	60	NuclAT_1	-	Antitoxin
-	55636..55695	+	60	NuclAT_1	-	Antitoxin
-	55636..55695	+	60	NuclAT_1	-	Antitoxin
C2L73_RS28260	55896..56126	-	231	WP_001736714.1	hypothetical protein	-
C2L73_RS28265	56290..56889	-	600	WP_032083981.1	hypothetical protein	-
C2L73_RS28270	57275..57475	-	201	WP_015059022.1	hypothetical protein	-
C2L73_RS28275	57607..58167	-	561	WP_000139328.1	fertility inhibition protein FinO	-
C2L73_RS28280	58222..58968	-	747	WP_000205770.1	conjugal transfer pilus acetylase TraX	-
C2L73_RS28285	58988..59149	-	162	Protein_82	DNA helicase	-
C2L73_RS28290	59213..59917	+	705	WP_001067855.1	IS6-like element IS26 family transposase	-
C2L73_RS28295	59970..60035	+	66	Protein_84	helix-turn-helix domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	rmtB / blaTEM-1B / blaCTX-M-65 / catA2 / blaKPC-2 / blaSHV-12	-	1..164501	164501

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-45)

Sequences

Toxin

Protein

• Length: 50 a.a.
• Molecular weight: 5542.67 Da
• Isoelectric Point: 8.7678

>T93456 WP_001312851.1 NZ_CP026141:c55591-55442 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 150 bp

>T93456 NZ_CP026141:c55591-55442 [Klebsiella pneumoniae]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT93456 NZ_CP026141:55636-55695 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A829C8K5

Antitoxin