Detailed information of TA system TA093429

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 65115..65368
• Replicon: plasmid pF77_1
• Accession: NZ_CP026137
• Organism: Klebsiella pneumoniae strain F77

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: G9G1E3
• Locus tag: C2L62_RS28370
• Protein ID: WP_001312851.1
• Coordinates: 65219..65368 (+)
• Length: 50 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	65115..65174 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
C2L62_RS28325	60516..60839	+	324	Protein_74	class II aldolase/adducin family protein	-
C2L62_RS28330	60893..61597	-	705	WP_001067855.1	IS6-like element IS26 family transposase	-
C2L62_RS28335	61661..61822	+	162	Protein_76	DNA helicase	-
C2L62_RS28340	61842..62588	+	747	WP_000205770.1	conjugal transfer pilus acetylase TraX	-
C2L62_RS28345	62643..63203	+	561	WP_000139328.1	fertility inhibition protein FinO	-
C2L62_RS28350	63335..63535	+	201	WP_015059022.1	hypothetical protein	-
C2L62_RS28355	63921..64520	+	600	WP_032083981.1	hypothetical protein	-
C2L62_RS28360	64684..64914	+	231	WP_001736714.1	hypothetical protein	-
-	65115..65174	-	60	NuclAT_0	-	Antitoxin
-	65115..65174	-	60	NuclAT_0	-	Antitoxin
-	65115..65174	-	60	NuclAT_0	-	Antitoxin
-	65115..65174	-	60	NuclAT_0	-	Antitoxin
C2L62_RS28370	65219..65368	+	150	WP_001312851.1	type I toxin-antitoxin system Hok family toxin	Toxin
C2L62_RS28375	65652..65900	+	249	WP_000083837.1	replication regulatory protein RepA	-
C2L62_RS28385	66145..66219	+	75	WP_001375168.1	RepA leader peptide Tap	-
C2L62_RS28390	66212..67069	+	858	WP_032495102.1	incFII family plasmid replication initiator RepA	-
C2L62_RS28400	68008..68661	+	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
C2L62_RS28405	68754..69011	+	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
C2L62_RS28410	68944..69345	+	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
C2L62_RS28415	69594..70009	+	416	Protein_89	IS1 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	catA2 / blaKPC-2 / blaSHV-12 / blaCTX-M-65 / fosA3	-	1..104887	104887

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-45)

Sequences

Toxin

Protein

• Length: 50 a.a.
• Molecular weight: 5542.67 Da
• Isoelectric Point: 8.7678

>T93429 WP_001312851.1 NZ_CP026137:65219-65368 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 150 bp

>T93429 NZ_CP026137:65219-65368 [Klebsiella pneumoniae]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT93429 NZ_CP026137:c65174-65115 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A829C8K5

Antitoxin