Detailed information of TA system TA093384

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 154403..154656
• Replicon: plasmid pF1_1
• Accession: NZ_CP026131
• Organism: Klebsiella pneumoniae strain F1

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: G9G1E3
• Locus tag: C2L60_RS29190
• Protein ID: WP_001312851.1
• Coordinates: 154403..154552 (-)
• Length: 50 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	154597..154656 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
C2L60_RS29140	149762..150177	-	416	Protein_191	IS1 family transposase	-
C2L60_RS29155	150426..150827	-	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
C2L60_RS30590	150760..151017	-	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
C2L60_RS29160	151110..151763	-	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
C2L60_RS29170	152702..153559	-	858	WP_032495102.1	incFII family plasmid replication initiator RepA	-
C2L60_RS29175	153552..153626	-	75	WP_001375168.1	RepA leader peptide Tap	-
C2L60_RS29185	153871..154119	-	249	WP_000083837.1	replication regulatory protein RepA	-
C2L60_RS29190	154403..154552	-	150	WP_001312851.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	154597..154656	+	60	NuclAT_1	-	Antitoxin
-	154597..154656	+	60	NuclAT_1	-	Antitoxin
-	154597..154656	+	60	NuclAT_1	-	Antitoxin
-	154597..154656	+	60	NuclAT_1	-	Antitoxin
C2L60_RS29200	154857..155087	-	231	WP_001736714.1	hypothetical protein	-
C2L60_RS29205	155251..155850	-	600	WP_032083981.1	hypothetical protein	-
C2L60_RS29210	156236..156436	-	201	WP_015059022.1	hypothetical protein	-
C2L60_RS29215	156568..157128	-	561	WP_000139328.1	fertility inhibition protein FinO	-
C2L60_RS29220	157183..157929	-	747	WP_000205770.1	conjugal transfer pilus acetylase TraX	-
C2L60_RS29225	157949..158110	-	162	Protein_204	DNA helicase	-
C2L60_RS29230	158174..158878	+	705	WP_001067855.1	IS6-like element IS26 family transposase	-
C2L60_RS29235	158931..158996	+	66	Protein_206	helix-turn-helix domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	catA2 / blaKPC-2 / blaSHV-12 / rmtB / blaTEM-1B / blaCTX-M-65	-	1..164510	164510

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-45)

Sequences

Toxin

Protein

• Length: 50 a.a.
• Molecular weight: 5542.67 Da
• Isoelectric Point: 8.7678

>T93384 WP_001312851.1 NZ_CP026131:c154552-154403 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 150 bp

>T93384 NZ_CP026131:c154552-154403 [Klebsiella pneumoniae]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT93384 NZ_CP026131:154597-154656 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A829C8K5

Antitoxin