Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2664035..2664260 | Replicon | chromosome |
| Accession | NZ_CP026098 | ||
| Organism | Shigella flexneri strain FDAARGOS_74 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | MC63_RS13605 | Protein ID | WP_000813254.1 |
| Coordinates | 2664035..2664190 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2664202..2664260 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MC63_RS13570 | 2659294..2659659 | + | 366 | WP_000124119.1 | hypothetical protein | - |
| MC63_RS13575 | 2659659..2660846 | + | 1188 | Protein_2591 | IS91 family transposase | - |
| MC63_RS13580 | 2661258..2661812 | - | 555 | WP_000640143.1 | DUF1133 family protein | - |
| MC63_RS13585 | 2661809..2662099 | - | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
| MC63_RS13590 | 2662099..2662698 | - | 600 | WP_000940329.1 | DUF1367 family protein | - |
| MC63_RS13595 | 2662832..2663529 | + | 698 | WP_225620307.1 | IS1 family transposase | - |
| MC63_RS13605 | 2664035..2664190 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2664202..2664260 | + | 59 | - | - | Antitoxin |
| MC63_RS13610 | 2664645..2665010 | - | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
| MC63_RS25720 | 2665010..2665675 | - | 666 | WP_005115317.1 | hypothetical protein | - |
| MC63_RS13620 | 2665675..2666037 | - | 363 | Protein_2599 | HNH endonuclease | - |
| MC63_RS13625 | 2666039..2666257 | - | 219 | WP_000256997.1 | DUF4014 family protein | - |
| MC63_RS13630 | 2666350..2666706 | - | 357 | WP_000403784.1 | hypothetical protein | - |
| MC63_RS13635 | 2666764..2667186 | - | 423 | WP_001118171.1 | DUF977 family protein | - |
| MC63_RS13640 | 2667201..2667947 | - | 747 | WP_000788996.1 | ATP-binding protein | - |
| MC63_RS25725 | 2668093..2668262 | - | 170 | Protein_2604 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2655005..2682834 | 27829 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T93302 WP_000813254.1 NZ_CP026098:c2664190-2664035 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T93302 NZ_CP026098:c2664190-2664035 [Shigella flexneri]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT93302 NZ_CP026098:2664202-2664260 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|