Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2150391..2150616 | Replicon | chromosome |
| Accession | NZ_CP026098 | ||
| Organism | Shigella flexneri strain FDAARGOS_74 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | MC63_RS10660 | Protein ID | WP_252988331.1 |
| Coordinates | 2150461..2150616 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2150391..2150449 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MC63_RS10615 | 2145702..2146320 | - | 619 | Protein_2031 | tyrosine-type recombinase/integrase | - |
| MC63_RS10620 | 2146383..2147539 | + | 1157 | WP_094099498.1 | IS3-like element IS600 family transposase | - |
| MC63_RS10625 | 2147579..2148019 | - | 441 | Protein_2033 | phage integrase N-terminal SAM-like domain-containing protein | - |
| MC63_RS10630 | 2148019..2148222 | - | 204 | WP_025759339.1 | DUF4224 domain-containing protein | - |
| MC63_RS10635 | 2148281..2148595 | - | 315 | WP_001317924.1 | 3'-5' exonuclease | - |
| MC63_RS10645 | 2149393..2149809 | + | 417 | WP_005069274.1 | hypothetical protein | - |
| - | 2150391..2150449 | - | 59 | - | - | Antitoxin |
| MC63_RS10660 | 2150461..2150616 | + | 156 | WP_252988331.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| MC63_RS10670 | 2150784..2151062 | + | 279 | WP_000929754.1 | hypothetical protein | - |
| MC63_RS10675 | 2151064..2152122 | + | 1059 | WP_025759819.1 | DUF968 domain-containing protein | - |
| MC63_RS10680 | 2152123..2152488 | + | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MC63_RS10685 | 2152485..2153200 | + | 716 | Protein_2042 | bacteriophage antitermination protein Q | - |
| MC63_RS10715 | 2153996..2154211 | + | 216 | WP_000839572.1 | class II holin family protein | - |
| MC63_RS10720 | 2154310..2154984 | + | 675 | WP_001088287.1 | IS66-like element accessory protein TnpA | - |
| MC63_RS10725 | 2154981..2155328 | + | 348 | WP_000631711.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ipaH9.8 | 2099825..2195515 | 95690 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5706.86 Da Isoelectric Point: 6.1531
>T93292 WP_252988331.1 NZ_CP026098:2150461-2150616 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRAGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRAGQTEVAVFTAYEPEE
Download Length: 156 bp
>T93292 NZ_CP026098:2150461-2150616 [Shigella flexneri]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAGCCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAGCCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT93292 NZ_CP026098:c2150449-2150391 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|