Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2535375..2535557 | Replicon | chromosome |
| Accession | NZ_CP026077 | ||
| Organism | Staphylococcus aureus strain FDAARGOS_7 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | RK65_RS14115 | Protein ID | WP_001801861.1 |
| Coordinates | 2535375..2535470 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2535498..2535557 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RK65_RS12835 | 2531035..2531661 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| RK65_RS12840 | 2531702..2532046 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| RK65_RS12845 | 2532144..2532695 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| RK65_RS12850 | 2532913..2533554 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| RK65_RS12855 | 2533668..2533853 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| RK65_RS12860 | 2533855..2534031 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| RK65_RS12865 | 2534042..2534425 | - | 384 | WP_000070812.1 | hypothetical protein | - |
| RK65_RS12875 | 2535029..2535172 | - | 144 | WP_001549059.1 | transposase | - |
| RK65_RS14115 | 2535375..2535470 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 2535498..2535557 | - | 60 | - | - | Antitoxin |
| RK65_RS12885 | 2535593..2535694 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| RK65_RS12890 | 2535672..2535848 | - | 177 | Protein_2419 | transposase | - |
| RK65_RS12895 | 2536042..2536419 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T93209 WP_001801861.1 NZ_CP026077:2535375-2535470 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T93209 NZ_CP026077:2535375-2535470 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT93209 NZ_CP026077:c2535557-2535498 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|