Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 340328..340508 | Replicon | chromosome |
| Accession | NZ_CP026074 | ||
| Organism | Staphylococcus aureus strain FDAARGOS_47 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | RL05_RS15300 | Protein ID | WP_001801861.1 |
| Coordinates | 340328..340423 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 340451..340508 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RL05_RS01775 | 335491..336141 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| RL05_RS01780 | 336222..337217 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| RL05_RS01785 | 337292..337918 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| RL05_RS01790 | 337959..338300 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| RL05_RS01795 | 338401..338973 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| RL05_RS01800 | 339171..340183 | - | 1013 | Protein_350 | IS3 family transposase | - |
| RL05_RS15300 | 340328..340423 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 340451..340508 | - | 58 | - | - | Antitoxin |
| RL05_RS01805 | 340546..340647 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| RL05_RS01810 | 340625..340786 | - | 162 | Protein_353 | transposase | - |
| RL05_RS01815 | 340777..341271 | - | 495 | Protein_354 | transposase | - |
| RL05_RS01820 | 341723..342952 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| RL05_RS01825 | 342945..344501 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| RL05_RS01830 | 344665..344799 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA / selk | 334733..410704 | 75971 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T93165 WP_001801861.1 NZ_CP026074:340328-340423 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T93165 NZ_CP026074:340328-340423 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT93165 NZ_CP026074:c340508-340451 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|