Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 228890..229072 | Replicon | chromosome |
| Accession | NZ_CP026073 | ||
| Organism | Staphylococcus aureus strain FDAARGOS_42 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | RL00_RS14620 | Protein ID | WP_001801861.1 |
| Coordinates | 228977..229072 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 228890..228949 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RL00_RS01465 | 228028..228405 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| RL00_RS01470 | 228599..228775 | + | 177 | Protein_236 | transposase | - |
| RL00_RS01475 | 228753..228854 | - | 102 | WP_001791893.1 | hypothetical protein | - |
| - | 228890..228949 | + | 60 | - | - | Antitoxin |
| RL00_RS14620 | 228977..229072 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| RL00_RS01485 | 229275..229418 | + | 144 | WP_001549059.1 | transposase | - |
| RL00_RS01495 | 230022..230405 | + | 384 | WP_000070811.1 | hypothetical protein | - |
| RL00_RS01500 | 230416..230592 | + | 177 | WP_000375477.1 | hypothetical protein | - |
| RL00_RS01510 | 230966..231523 | + | 558 | Protein_242 | ImmA/IrrE family metallo-endopeptidase | - |
| RL00_RS01515 | 231721..232293 | - | 573 | WP_000414202.1 | hypothetical protein | - |
| RL00_RS01520 | 232394..232735 | - | 342 | WP_000627541.1 | DUF3969 family protein | - |
| RL00_RS01525 | 232776..233402 | - | 627 | WP_000669017.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 210718..235960 | 25242 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T93143 WP_001801861.1 NZ_CP026073:c229072-228977 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T93143 NZ_CP026073:c229072-228977 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT93143 NZ_CP026073:228890-228949 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|