Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2592406..2592588 | Replicon | chromosome |
| Accession | NZ_CP026072 | ||
| Organism | Staphylococcus aureus strain FDAARGOS_35 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | RK93_RS15805 | Protein ID | WP_001801861.1 |
| Coordinates | 2592493..2592588 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2592406..2592465 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RK93_RS13790 | 2591544..2591921 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| RK93_RS13795 | 2592115..2592291 | + | 177 | Protein_2547 | transposase | - |
| RK93_RS13800 | 2592269..2592370 | - | 102 | WP_001791893.1 | hypothetical protein | - |
| - | 2592406..2592465 | + | 60 | - | - | Antitoxin |
| RK93_RS15805 | 2592493..2592588 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| RK93_RS13810 | 2592791..2592934 | + | 144 | WP_001549059.1 | transposase | - |
| RK93_RS13820 | 2593538..2593921 | + | 384 | WP_000070811.1 | hypothetical protein | - |
| RK93_RS13825 | 2593932..2594108 | + | 177 | WP_000375476.1 | hypothetical protein | - |
| RK93_RS13830 | 2594110..2594295 | + | 186 | WP_000809857.1 | hypothetical protein | - |
| RK93_RS13835 | 2594409..2595050 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| RK93_RS13840 | 2595268..2595819 | - | 552 | WP_000414205.1 | hypothetical protein | - |
| RK93_RS13845 | 2595917..2596261 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
| RK93_RS13850 | 2596302..2596928 | - | 627 | WP_000669046.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2573886..2618613 | 44727 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T93137 WP_001801861.1 NZ_CP026072:c2592588-2592493 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T93137 NZ_CP026072:c2592588-2592493 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT93137 NZ_CP026072:2592406-2592465 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|