Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 337190..337370 | Replicon | chromosome |
| Accession | NZ_CP026071 | ||
| Organism | Staphylococcus aureus strain FDAARGOS_30 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | RK88_RS14780 | Protein ID | WP_001801861.1 |
| Coordinates | 337275..337370 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 337190..337247 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RK88_RS02085 | 332603..335023 | - | 2421 | WP_000182553.1 | polysaccharide lyase 8 family protein | - |
| RK88_RS02090 | 335548..335990 | + | 443 | Protein_355 | DUF1433 domain-containing protein | - |
| RK88_RS02095 | 335990..336433 | + | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
| RK88_RS02100 | 336433..336876 | + | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
| RK88_RS02105 | 337051..337152 | - | 102 | WP_001791232.1 | hypothetical protein | - |
| - | 337190..337247 | + | 58 | - | - | Antitoxin |
| RK88_RS14780 | 337275..337370 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| RK88_RS02115 | 337821..338267 | + | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
| RK88_RS02120 | 338460..339029 | + | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
| RK88_RS02125 | 339029..340396 | + | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
| RK88_RS02130 | 340545..341117 | - | 573 | WP_000414222.1 | hypothetical protein | - |
| RK88_RS02135 | 341215..341559 | - | 345 | WP_000627550.1 | DUF3969 family protein | - |
| RK88_RS02140 | 341600..342226 | - | 627 | WP_000669038.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | selk / hysA | 307428..344786 | 37358 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T93101 WP_001801861.1 NZ_CP026071:c337370-337275 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T93101 NZ_CP026071:c337370-337275 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT93101 NZ_CP026071:337190-337247 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|