Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1980511..1980693 | Replicon | chromosome |
Accession | NZ_CP026070 | ||
Organism | Staphylococcus aureus strain FDAARGOS_27 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | RK85_RS14315 | Protein ID | WP_001801861.1 |
Coordinates | 1980598..1980693 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1980511..1980570 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RK85_RS10520 | 1979649..1980026 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
RK85_RS10525 | 1980220..1980396 | + | 177 | Protein_1926 | transposase | - |
RK85_RS10530 | 1980374..1980475 | - | 102 | WP_001791893.1 | hypothetical protein | - |
- | 1980511..1980570 | + | 60 | - | - | Antitoxin |
RK85_RS14315 | 1980598..1980693 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
RK85_RS10540 | 1980896..1981039 | + | 144 | WP_001549059.1 | transposase | - |
RK85_RS10550 | 1981643..1982026 | + | 384 | WP_000070812.1 | hypothetical protein | - |
RK85_RS10555 | 1982037..1982213 | + | 177 | WP_000375476.1 | hypothetical protein | - |
RK85_RS10560 | 1982215..1982400 | + | 186 | WP_000809857.1 | hypothetical protein | - |
RK85_RS10565 | 1982514..1983155 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
RK85_RS10570 | 1983373..1983924 | - | 552 | WP_000414205.1 | hypothetical protein | - |
RK85_RS10575 | 1984022..1984366 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
RK85_RS10580 | 1984407..1985033 | - | 627 | WP_000669046.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T93092 WP_001801861.1 NZ_CP026070:c1980693-1980598 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T93092 NZ_CP026070:c1980693-1980598 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT93092 NZ_CP026070:1980511-1980570 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|