Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1617348..1617528 | Replicon | chromosome |
Accession | NZ_CP026069 | ||
Organism | Staphylococcus aureus strain FDAARGOS_25 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | RK83_RS15080 | Protein ID | WP_001801861.1 |
Coordinates | 1617433..1617528 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1617348..1617405 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RK83_RS08550 | 1613057..1613191 | + | 135 | WP_001791797.1 | hypothetical protein | - |
RK83_RS08555 | 1613355..1614911 | + | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
RK83_RS08560 | 1614904..1616133 | + | 1230 | WP_000072626.1 | restriction endonuclease subunit S | - |
RK83_RS08565 | 1616585..1617079 | + | 495 | Protein_1564 | transposase | - |
RK83_RS08570 | 1617070..1617231 | + | 162 | Protein_1565 | transposase | - |
RK83_RS08575 | 1617209..1617310 | - | 102 | WP_001792025.1 | hypothetical protein | - |
- | 1617348..1617405 | + | 58 | - | - | Antitoxin |
RK83_RS15080 | 1617433..1617528 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
RK83_RS08580 | 1617673..1618685 | + | 1013 | Protein_1568 | IS3 family transposase | - |
RK83_RS08585 | 1618883..1619455 | - | 573 | WP_000414216.1 | hypothetical protein | - |
RK83_RS08590 | 1619556..1619897 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
RK83_RS08595 | 1619938..1620564 | - | 627 | WP_000669024.1 | hypothetical protein | - |
RK83_RS08600 | 1620639..1621634 | - | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
RK83_RS08605 | 1621715..1622365 | - | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk / hlgA / lukD | 1590516..1641546 | 51030 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T93069 WP_001801861.1 NZ_CP026069:c1617528-1617433 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T93069 NZ_CP026069:c1617528-1617433 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT93069 NZ_CP026069:1617348-1617405 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|