Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 218832..219016 | Replicon | chromosome |
Accession | NZ_CP026069 | ||
Organism | Staphylococcus aureus strain FDAARGOS_25 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | RK83_RS01260 | Protein ID | WP_000482652.1 |
Coordinates | 218909..219016 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 218832..218892 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RK83_RS01235 | 214287..214454 | - | 168 | Protein_233 | hypothetical protein | - |
RK83_RS01245 | 214685..216418 | - | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein/permease | - |
RK83_RS01250 | 216443..218206 | - | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
- | 218832..218892 | + | 61 | - | - | Antitoxin |
RK83_RS01260 | 218909..219016 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
RK83_RS01265 | 219150..219536 | - | 387 | WP_000779360.1 | flippase GtxA | - |
RK83_RS01270 | 219804..220946 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
RK83_RS01275 | 221006..221665 | + | 660 | WP_000831298.1 | membrane protein | - |
RK83_RS01280 | 221847..223058 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
RK83_RS01285 | 223181..223654 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T93061 WP_000482652.1 NZ_CP026069:c219016-218909 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T93061 NZ_CP026069:c219016-218909 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT93061 NZ_CP026069:218832-218892 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|