Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1295986..1296168 | Replicon | chromosome |
Accession | NZ_CP026068 | ||
Organism | Staphylococcus aureus strain FDAARGOS_24 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | RK82_RS13915 | Protein ID | WP_001801861.1 |
Coordinates | 1295986..1296081 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1296109..1296168 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RK82_RS06450 | 1291646..1292272 | + | 627 | WP_000669046.1 | hypothetical protein | - |
RK82_RS06455 | 1292313..1292657 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
RK82_RS06460 | 1292755..1293306 | + | 552 | WP_000414205.1 | hypothetical protein | - |
RK82_RS06465 | 1293524..1294165 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
RK82_RS06470 | 1294279..1294464 | - | 186 | WP_000809857.1 | hypothetical protein | - |
RK82_RS06475 | 1294466..1294642 | - | 177 | WP_000375476.1 | hypothetical protein | - |
RK82_RS06480 | 1294653..1295036 | - | 384 | WP_000070812.1 | hypothetical protein | - |
RK82_RS06490 | 1295640..1295783 | - | 144 | WP_001549059.1 | transposase | - |
RK82_RS13915 | 1295986..1296081 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1296109..1296168 | - | 60 | - | - | Antitoxin |
RK82_RS06500 | 1296204..1296305 | + | 102 | WP_001791893.1 | hypothetical protein | - |
RK82_RS06505 | 1296283..1296459 | - | 177 | Protein_1233 | transposase | - |
RK82_RS06510 | 1296653..1297030 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 1269959..1348500 | 78541 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T93050 WP_001801861.1 NZ_CP026068:1295986-1296081 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T93050 NZ_CP026068:1295986-1296081 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT93050 NZ_CP026068:c1296168-1296109 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|